BLASTX nr result
ID: Mentha24_contig00013573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00013573 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39573.1| hypothetical protein MIMGU_mgv1a010238mg [Mimulus... 59 7e-07 >gb|EYU39573.1| hypothetical protein MIMGU_mgv1a010238mg [Mimulus guttatus] Length = 318 Score = 58.9 bits (141), Expect = 7e-07 Identities = 40/90 (44%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +2 Query: 68 VRLNRSAGWGRRTTAFAPPAHRSIALR--SGRELHRFSSDCGSGEVGRKLFCNSKADFGS 241 +R N S+ R T A R I R G++ FSS +G + KLFCNSK Sbjct: 35 LRPNLSSVCWRSTIPRATAEQRPITWRISGGQKSRPFSSGSVNGGLKGKLFCNSKTK--- 91 Query: 242 IMCATVNGKAESQSDVSPPTQKLNGKPPAK 331 MCATVNGKA++QSDV PP+++ + KPPA+ Sbjct: 92 -MCATVNGKADNQSDV-PPSRENHEKPPAE 119