BLASTX nr result
ID: Mentha24_contig00010826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00010826 (478 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22190.1| hypothetical protein MIMGU_mgv1a012744mg [Mimulus... 59 5e-07 >gb|EYU22190.1| hypothetical protein MIMGU_mgv1a012744mg [Mimulus guttatus] Length = 241 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +3 Query: 120 MQSLYGKFRLVTKQTISSLKNVELSKVASFDSRFSGSMNRCSGFNSG-RSCSSAAFLLNK 296 MQS+ GK RLV KQ ++LKN EL +ASFDS+ G S FNS RS ++ LL+K Sbjct: 1 MQSMCGKLRLVAKQAFNNLKNAELKPIASFDSKLFGCSIPSSAFNSSHRSNFASELLLSK 60 Query: 297 NIGT 308 N GT Sbjct: 61 NFGT 64