BLASTX nr result
ID: Mentha23_contig00048267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00048267 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524292.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 >ref|XP_002524292.1| conserved hypothetical protein [Ricinus communis] gi|223536383|gb|EEF38032.1| conserved hypothetical protein [Ricinus communis] Length = 407 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/80 (42%), Positives = 47/80 (58%) Frame = +2 Query: 2 SAEASILCSHLITRLIQLQSDYKSIDGAISSAQRDGDTCPVISDLLRARVALTDRPPFSD 181 SAEAS +CSHL+ + Q+QS+Y+ I GAI S D V + + + R PFS Sbjct: 102 SAEASKICSHLLKNINQIQSNYEFIRGAIDSTIDDYSPEKVKLIVSKLNSFIIQRNPFST 161 Query: 182 LDRQEFKRAQEKHSSVLHQL 241 D+ +FK +K+SSVLH L Sbjct: 162 PDKNDFKLINDKYSSVLHHL 181