BLASTX nr result
ID: Mentha23_contig00040275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00040275 (775 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 78 3e-12 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 78.2 bits (191), Expect = 3e-12 Identities = 49/137 (35%), Positives = 75/137 (54%), Gaps = 1/137 (0%) Frame = -2 Query: 747 IQRFDFSTEKFSYIPFPHTGKLLQEKHTHQLFDFGGRLGVVVYPWFDFRSEGKFEIWSWN 568 I FD + EKFS +P P G L + + QL DF G LG +VYP +E ++W N Sbjct: 239 ILSFDMANEKFSTLPLPTFGGSLAQYYL-QLLDFNGSLGAIVYPREG--TEKSIDLWVMN 295 Query: 567 EGCWSLVFD-EYIADAREPIGFSRDGQVLFLVGKDRLLRVYYLRTKQAKKVDVYCNKFLF 391 G W+ F E ++ P+GF ++G+ LFL + L ++ T++ K + ++ + Sbjct: 296 -GSWTRQFSIESVSGVERPLGFWKNGE-LFLESSNHELVLFDPATRELKNLGIHAYQNTM 353 Query: 390 ELIPYVESLHPLNGEPE 340 +LI YVESL P+NG E Sbjct: 354 QLIAYVESLVPINGRSE 370