BLASTX nr result
ID: Mentha23_contig00033373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033373 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32224.1| hypothetical protein MIMGU_mgv1a026990mg [Mimulus... 64 2e-08 >gb|EYU32224.1| hypothetical protein MIMGU_mgv1a026990mg [Mimulus guttatus] Length = 518 Score = 63.9 bits (154), Expect = 2e-08 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 4/70 (5%) Frame = -2 Query: 199 PKFLISSPKMPSSACAVPFFLSCNPSRLQKSK----YYPNFCLSKTSFLGQSLVLRGNNE 32 PKFLISS K S CA+PFF S N S LQK K + L KT FLGQ+LV R +NE Sbjct: 3 PKFLISSHKASPSVCALPFFPSRNSSLLQKPKSCRLSLSSEKLKKTPFLGQNLVFRESNE 62 Query: 31 PCTNSRKQFP 2 NSR +FP Sbjct: 63 SYANSRSRFP 72