BLASTX nr result
ID: Mentha23_contig00033359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033359 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus... 128 7e-28 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 125 5e-27 emb|CBI24015.3| unnamed protein product [Vitis vinifera] 125 8e-27 ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containi... 125 8e-27 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 124 1e-26 ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prun... 124 1e-26 gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis] 124 2e-26 ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containi... 120 2e-25 gb|EPS69231.1| hypothetical protein M569_05535 [Genlisea aurea] 120 3e-25 ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containi... 120 3e-25 ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|NP_196272.1| pentatricopeptide repeat-containing protein [Ar... 119 4e-25 ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily pr... 119 6e-25 ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phas... 118 7e-25 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 118 1e-24 gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] 117 1e-24 ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 116 3e-24 ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containi... 116 4e-24 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 116 4e-24 >gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus guttatus] Length = 621 Score = 128 bits (322), Expect = 7e-28 Identities = 57/66 (86%), Positives = 62/66 (93%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIA+GL+KTK GETIRVTKNLRVC+DCH ASKLIS YDREI+VRDRNRFHHFRGG+C Sbjct: 556 KLAIAYGLLKTKAGETIRVTKNLRVCRDCHVASKLISMVYDREIVVRDRNRFHHFRGGLC 615 Query: 121 SCNDYW 104 SCNDYW Sbjct: 616 SCNDYW 621 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 125 bits (315), Expect = 5e-27 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+K+KPGE +R+TKNLRVCKDCH+ASK IS+ YDREIIVRDRNRFHHF+GG C Sbjct: 563 KLAIAFGLLKSKPGEILRITKNLRVCKDCHQASKFISKVYDREIIVRDRNRFHHFKGGEC 622 Query: 121 SCNDYW 104 SC DYW Sbjct: 623 SCKDYW 628 >emb|CBI24015.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 125 bits (313), Expect = 8e-27 Identities = 53/66 (80%), Positives = 62/66 (93%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+KTKPGET+R++KNLR+C+DCH+ASKLIS+ YDREII+RDRNRFHHFR G C Sbjct: 504 KLAIAFGLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHFRMGGC 563 Query: 121 SCNDYW 104 SC DYW Sbjct: 564 SCKDYW 569 >ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 624 Score = 125 bits (313), Expect = 8e-27 Identities = 53/66 (80%), Positives = 62/66 (93%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+KTKPGET+R++KNLR+C+DCH+ASKLIS+ YDREII+RDRNRFHHFR G C Sbjct: 559 KLAIAFGLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHFRMGGC 618 Query: 121 SCNDYW 104 SC DYW Sbjct: 619 SCKDYW 624 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 124 bits (312), Expect = 1e-26 Identities = 53/68 (77%), Positives = 63/68 (92%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL++T+PG+T+RVTKNLRVC+DCHEA+KLIS ++REI+VRDRNRFHHFR G C Sbjct: 368 KLAIAFGLLRTRPGDTMRVTKNLRVCRDCHEATKLISRVFEREIVVRDRNRFHHFRDGAC 427 Query: 121 SCNDYW*K 98 SCNDYW K Sbjct: 428 SCNDYWGK 435 >ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] gi|462423715|gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] Length = 624 Score = 124 bits (312), Expect = 1e-26 Identities = 54/66 (81%), Positives = 62/66 (93%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+KTKPGET+R++KNLRVCKDCH+ASKLIS+ +DREIIVRDRNRFHHF+ G C Sbjct: 559 KLAIAFGLLKTKPGETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKRGDC 618 Query: 121 SCNDYW 104 SC DYW Sbjct: 619 SCKDYW 624 >gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis] Length = 633 Score = 124 bits (310), Expect = 2e-26 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+KTKPGETIR++KNLRVCKDCH ASKL+S+ ++REIIVRDRNRFHHFR G C Sbjct: 568 KLAIAFGLLKTKPGETIRISKNLRVCKDCHNASKLVSKVFEREIIVRDRNRFHHFRMGEC 627 Query: 121 SCNDYW 104 SC DYW Sbjct: 628 SCQDYW 633 >ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 601 Score = 120 bits (301), Expect = 2e-25 Identities = 49/66 (74%), Positives = 60/66 (90%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL++T+PG+T+R+TKNLRVC+DCHEA+K +S +DREI+VRDRNRFHHFR G C Sbjct: 536 KLAIAFGLLRTRPGDTMRITKNLRVCRDCHEATKFVSRVFDREIVVRDRNRFHHFRDGKC 595 Query: 121 SCNDYW 104 SC DYW Sbjct: 596 SCKDYW 601 >gb|EPS69231.1| hypothetical protein M569_05535 [Genlisea aurea] Length = 628 Score = 120 bits (300), Expect = 3e-25 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 1/67 (1%) Frame = -1 Query: 301 KLAIAFGLIKTKPG-ETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGV 125 KLAIA+GL+KTK G + +RVTKNLRVC+DCHEASKLIS YDREIIVRDRNRFHHFR GV Sbjct: 562 KLAIAYGLLKTKAGGDPVRVTKNLRVCRDCHEASKLISACYDREIIVRDRNRFHHFRRGV 621 Query: 124 CSCNDYW 104 CSCND+W Sbjct: 622 CSCNDFW 628 >ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 626 Score = 120 bits (300), Expect = 3e-25 Identities = 51/66 (77%), Positives = 60/66 (90%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+K+KPG+ +R+TKNLRVCKDCH+ASK IS+ Y+ EIIVRDRNRFHHF+GG C Sbjct: 561 KLAIAFGLLKSKPGDILRITKNLRVCKDCHQASKFISKVYNLEIIVRDRNRFHHFKGGEC 620 Query: 121 SCNDYW 104 SC DYW Sbjct: 621 SCKDYW 626 >ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Brachypodium distachyon] Length = 599 Score = 119 bits (299), Expect = 3e-25 Identities = 48/66 (72%), Positives = 60/66 (90%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL++T+PG+T+R+TKNLRVC+DCHEA+K IS ++REI+VRDRNRFHHF+ G C Sbjct: 534 KLAIAFGLLRTRPGDTVRITKNLRVCRDCHEATKFISRVFEREIVVRDRNRFHHFKDGTC 593 Query: 121 SCNDYW 104 SC DYW Sbjct: 594 SCRDYW 599 >ref|NP_196272.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170345|sp|Q9FG16.1|PP367_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g06540 gi|10178110|dbj|BAB11403.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332003649|gb|AED91032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 622 Score = 119 bits (298), Expect = 4e-25 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIA+G++KTKPG TIR+ KNLRVC+DCH +KLISE Y RE+IVRDRNRFHHFR GVC Sbjct: 557 KLAIAYGMMKTKPGTTIRIVKNLRVCEDCHTVTKLISEVYGRELIVRDRNRFHHFRNGVC 616 Query: 121 SCNDYW 104 SC DYW Sbjct: 617 SCRDYW 622 >ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508715014|gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 628 Score = 119 bits (297), Expect = 6e-25 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIA GL+KTK GET R+TKNLRVC+DCH ASKLIS+ +DREIIVRDRNRFHHF+ G C Sbjct: 563 KLAIALGLLKTKTGETFRITKNLRVCRDCHHASKLISKVFDREIIVRDRNRFHHFKDGEC 622 Query: 121 SCNDYW 104 SC DYW Sbjct: 623 SCKDYW 628 >ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris] gi|561027818|gb|ESW26458.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris] Length = 604 Score = 118 bits (296), Expect = 7e-25 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIA+GL+KTK GET+RVTKNLRVCKDCH+ASKLIS YD +II+RDRNRFHHF G C Sbjct: 539 KLAIAYGLLKTKRGETLRVTKNLRVCKDCHQASKLISRVYDCDIIIRDRNRFHHFSNGEC 598 Query: 121 SCNDYW 104 SC DYW Sbjct: 599 SCKDYW 604 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 118 bits (295), Expect = 1e-24 Identities = 51/66 (77%), Positives = 61/66 (92%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+K++PG TIR++KNLRVC DCH A+KLIS+ Y+REIIVRDRNRFHHF+ G+C Sbjct: 680 KLAIAFGLMKSRPGATIRLSKNLRVCIDCHSATKLISKVYNREIIVRDRNRFHHFKDGLC 739 Query: 121 SCNDYW 104 SCNDYW Sbjct: 740 SCNDYW 745 >gb|EMT27117.1| hypothetical protein F775_08942 [Aegilops tauschii] Length = 588 Score = 117 bits (294), Expect = 1e-24 Identities = 50/66 (75%), Positives = 61/66 (92%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+K++PG TIR++KNLRVC DCH A+KLIS+ Y+REI+VRDRNRFHHF+ G+C Sbjct: 523 KLAIAFGLMKSRPGATIRLSKNLRVCVDCHAATKLISKVYNREIVVRDRNRFHHFKDGLC 582 Query: 121 SCNDYW 104 SCNDYW Sbjct: 583 SCNDYW 588 >ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Oryza brachyantha] Length = 598 Score = 117 bits (293), Expect = 2e-24 Identities = 47/66 (71%), Positives = 59/66 (89%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL++ +P ET+R+TKNLRVC+DCHEA+K++S +DREI+VRDRNRFHHF+ G C Sbjct: 533 KLAIAFGLLRARPRETLRITKNLRVCRDCHEATKIVSRVFDREIVVRDRNRFHHFKDGTC 592 Query: 121 SCNDYW 104 SC DYW Sbjct: 593 SCKDYW 598 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 116 bits (291), Expect = 3e-24 Identities = 50/66 (75%), Positives = 59/66 (89%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+K +PG TIR++KNLRVC DCH A+KLIS+ Y+REI+VRDRNRFHHF+ G C Sbjct: 630 KLAIAFGLMKLRPGTTIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGSC 689 Query: 121 SCNDYW 104 SCNDYW Sbjct: 690 SCNDYW 695 >ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 607 Score = 116 bits (290), Expect = 4e-24 Identities = 50/66 (75%), Positives = 59/66 (89%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIA+GL+KTK GET+RVTKNLRVCKDCH+ASK+IS+ YD +II+RDR+RFHHF G C Sbjct: 542 KLAIAYGLLKTKRGETLRVTKNLRVCKDCHQASKMISKVYDCDIIIRDRSRFHHFSNGEC 601 Query: 121 SCNDYW 104 SC DYW Sbjct: 602 SCKDYW 607 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 116 bits (290), Expect = 4e-24 Identities = 50/66 (75%), Positives = 58/66 (87%) Frame = -1 Query: 301 KLAIAFGLIKTKPGETIRVTKNLRVCKDCHEASKLISEAYDREIIVRDRNRFHHFRGGVC 122 KLAIAFGL+K PG TIR++KNLRVC DCH A+KLIS+ Y+REI+VRDRNRFHHF+ G C Sbjct: 628 KLAIAFGLMKLDPGATIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGTC 687 Query: 121 SCNDYW 104 SCNDYW Sbjct: 688 SCNDYW 693