BLASTX nr result
ID: Mentha23_contig00033259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033259 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19060.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002284405.1| PREDICTED: uncharacterized protein LOC100254... 64 2e-08 emb|CAN68379.1| hypothetical protein VITISV_018905 [Vitis vinifera] 64 2e-08 gb|EXB44345.1| UPF0695 membrane protein [Morus notabilis] 63 5e-08 ref|XP_002879949.1| camphor resistance CrcB family protein [Arab... 60 2e-07 ref|XP_006411437.1| hypothetical protein EUTSA_v10016628mg [Eutr... 60 3e-07 ref|XP_006294175.1| hypothetical protein CARUB_v10023169mg [Caps... 60 3e-07 ref|XP_004290836.1| PREDICTED: UPF0695 membrane protein C977.11/... 60 4e-07 ref|XP_007137379.1| hypothetical protein PHAVU_009G122400g [Phas... 59 5e-07 ref|XP_006472733.1| PREDICTED: UPF0695 membrane protein YPL279C-... 59 9e-07 ref|XP_006472731.1| PREDICTED: UPF0695 membrane protein YPL279C-... 59 9e-07 ref|XP_006434139.1| hypothetical protein CICLE_v10001037mg [Citr... 59 9e-07 ref|XP_007223109.1| hypothetical protein PRUPE_ppa005411mg [Prun... 59 9e-07 ref|NP_565956.1| camphor resistance CrcB-like protein [Arabidops... 59 9e-07 ref|XP_003601082.1| CrcB-like protein [Medicago truncatula] gi|3... 57 3e-06 gb|EYU22936.1| hypothetical protein MIMGU_mgv1a006798mg [Mimulus... 55 8e-06 ref|XP_007018992.1| Camphor resistance CrcB family protein, puta... 55 8e-06 ref|XP_007018991.1| Camphor resistance CrcB family protein, puta... 55 8e-06 >emb|CBI19060.3| unnamed protein product [Vitis vinifera] Length = 528 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S HPWRAYAYA +TI +SF +GTLIYSVPVW KGYD Sbjct: 493 SHHPWRAYAYAMLTIFLSFGLGTLIYSVPVWTKGYD 528 >ref|XP_002284405.1| PREDICTED: uncharacterized protein LOC100254107 [Vitis vinifera] Length = 510 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S HPWRAYAYA +TI +SF +GTLIYSVPVW KGYD Sbjct: 475 SHHPWRAYAYAMLTIFLSFGLGTLIYSVPVWTKGYD 510 >emb|CAN68379.1| hypothetical protein VITISV_018905 [Vitis vinifera] Length = 399 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S HPWRAYAYA +TI +SF +GTLIYSVPVW KGYD Sbjct: 364 SHHPWRAYAYAMLTIFLSFGLGTLIYSVPVWTKGYD 399 >gb|EXB44345.1| UPF0695 membrane protein [Morus notabilis] Length = 920 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S HPWRAYAYA ITI +SF +G LIYSVPVW KGY Sbjct: 885 SKHPWRAYAYAMITICISFALGILIYSVPVWTKGY 919 >ref|XP_002879949.1| camphor resistance CrcB family protein [Arabidopsis lyrata subsp. lyrata] gi|297325788|gb|EFH56208.1| camphor resistance CrcB family protein [Arabidopsis lyrata subsp. lyrata] Length = 462 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S +PWRAYAYA TIAVSF +GT+IYSVPVWV G++ Sbjct: 427 SDYPWRAYAYASFTIAVSFAIGTVIYSVPVWVVGFN 462 >ref|XP_006411437.1| hypothetical protein EUTSA_v10016628mg [Eutrema salsugineum] gi|567215579|ref|XP_006411438.1| hypothetical protein EUTSA_v10016628mg [Eutrema salsugineum] gi|557112606|gb|ESQ52890.1| hypothetical protein EUTSA_v10016628mg [Eutrema salsugineum] gi|557112607|gb|ESQ52891.1| hypothetical protein EUTSA_v10016628mg [Eutrema salsugineum] Length = 460 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 289 HPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 +PWRAYAYA TIAVSF +GT+IYSVPVWV G+ Sbjct: 427 YPWRAYAYASFTIAVSFAIGTVIYSVPVWVAGF 459 >ref|XP_006294175.1| hypothetical protein CARUB_v10023169mg [Capsella rubella] gi|482562883|gb|EOA27073.1| hypothetical protein CARUB_v10023169mg [Capsella rubella] Length = 461 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S +PWRAYAYA TIAVSF +GT+IYSVPVWV G+ Sbjct: 426 SDYPWRAYAYASFTIAVSFAIGTVIYSVPVWVVGF 460 >ref|XP_004290836.1| PREDICTED: UPF0695 membrane protein C977.11/PB8B6.06c-like [Fragaria vesca subsp. vesca] Length = 449 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S H WRAY YA +TI SFC+GTLI+S+PVW KGY Sbjct: 414 SKHSWRAYTYAMVTICASFCLGTLIFSLPVWAKGY 448 >ref|XP_007137379.1| hypothetical protein PHAVU_009G122400g [Phaseolus vulgaris] gi|561010466|gb|ESW09373.1| hypothetical protein PHAVU_009G122400g [Phaseolus vulgaris] Length = 450 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S HPWRAY YA IT+ VSF +G LIY +PVW KG+D Sbjct: 412 SSHPWRAYVYAIITVCVSFSLGILIYCIPVWTKGFD 447 >ref|XP_006472733.1| PREDICTED: UPF0695 membrane protein YPL279C-like isoform X3 [Citrus sinensis] gi|568837445|ref|XP_006472734.1| PREDICTED: UPF0695 membrane protein YPL279C-like isoform X4 [Citrus sinensis] gi|568837447|ref|XP_006472735.1| PREDICTED: UPF0695 membrane protein YPL279C-like isoform X5 [Citrus sinensis] Length = 472 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S PWRAYAYA ITI +SF +G LIYSVPVW KGY+ Sbjct: 437 STSPWRAYAYALITILISFGLGILIYSVPVWTKGYN 472 >ref|XP_006472731.1| PREDICTED: UPF0695 membrane protein YPL279C-like isoform X1 [Citrus sinensis] gi|568837441|ref|XP_006472732.1| PREDICTED: UPF0695 membrane protein YPL279C-like isoform X2 [Citrus sinensis] Length = 514 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S PWRAYAYA ITI +SF +G LIYSVPVW KGY+ Sbjct: 479 STSPWRAYAYALITILISFGLGILIYSVPVWTKGYN 514 >ref|XP_006434139.1| hypothetical protein CICLE_v10001037mg [Citrus clementina] gi|567883163|ref|XP_006434140.1| hypothetical protein CICLE_v10001037mg [Citrus clementina] gi|557536261|gb|ESR47379.1| hypothetical protein CICLE_v10001037mg [Citrus clementina] gi|557536262|gb|ESR47380.1| hypothetical protein CICLE_v10001037mg [Citrus clementina] Length = 472 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S PWRAYAYA ITI +SF +G LIYSVPVW KGY+ Sbjct: 437 STSPWRAYAYALITILISFGLGILIYSVPVWTKGYN 472 >ref|XP_007223109.1| hypothetical protein PRUPE_ppa005411mg [Prunus persica] gi|462420045|gb|EMJ24308.1| hypothetical protein PRUPE_ppa005411mg [Prunus persica] Length = 462 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S +PWRAY YA +TI SF +GTLIYSVPVW KGY Sbjct: 427 SKYPWRAYTYAMVTICTSFGLGTLIYSVPVWTKGY 461 >ref|NP_565956.1| camphor resistance CrcB-like protein [Arabidopsis thaliana] gi|238479528|ref|NP_001154568.1| camphor resistance CrcB-like protein [Arabidopsis thaliana] gi|20196897|gb|AAM14827.1| Expressed protein [Arabidopsis thaliana] gi|26453266|dbj|BAC43706.1| unknown protein [Arabidopsis thaliana] gi|330254925|gb|AEC10019.1| camphor resistance CrcB-like protein [Arabidopsis thaliana] gi|330254926|gb|AEC10020.1| camphor resistance CrcB-like protein [Arabidopsis thaliana] Length = 461 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S +PWRAYAYA TI VSF +GT+IYSVPVWV G+ Sbjct: 426 SDYPWRAYAYASFTIVVSFAIGTIIYSVPVWVIGF 460 >ref|XP_003601082.1| CrcB-like protein [Medicago truncatula] gi|355490130|gb|AES71333.1| CrcB-like protein [Medicago truncatula] Length = 451 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S PWRAYAYA ITI VSF G LIY VP W KG+D Sbjct: 413 SSDPWRAYAYAAITICVSFSFGILIYCVPYWTKGFD 448 >gb|EYU22936.1| hypothetical protein MIMGU_mgv1a006798mg [Mimulus guttatus] Length = 431 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGYD 188 S + WR YAYA T +SF +GTLIYSVPVW +GYD Sbjct: 396 SKNTWRGYAYAATTFFISFILGTLIYSVPVWARGYD 431 >ref|XP_007018992.1| Camphor resistance CrcB family protein, putative isoform 2 [Theobroma cacao] gi|508724320|gb|EOY16217.1| Camphor resistance CrcB family protein, putative isoform 2 [Theobroma cacao] Length = 423 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S HPWRAYAYA IT VSF +G LIY+VP W KG+ Sbjct: 388 SKHPWRAYAYALITTGVSFGLGILIYNVPAWTKGF 422 >ref|XP_007018991.1| Camphor resistance CrcB family protein, putative isoform 1 [Theobroma cacao] gi|508724319|gb|EOY16216.1| Camphor resistance CrcB family protein, putative isoform 1 [Theobroma cacao] Length = 456 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 295 SIHPWRAYAYAGITIAVSFCMGTLIYSVPVWVKGY 191 S HPWRAYAYA IT VSF +G LIY+VP W KG+ Sbjct: 421 SKHPWRAYAYALITTGVSFGLGILIYNVPAWTKGF 455