BLASTX nr result
ID: Mentha23_contig00033231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033231 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477817.1| PREDICTED: bidirectional sugar transporter S... 57 3e-06 ref|XP_006477816.1| PREDICTED: bidirectional sugar transporter S... 57 3e-06 ref|XP_006442343.1| hypothetical protein CICLE_v10021714mg [Citr... 57 3e-06 ref|XP_006442342.1| hypothetical protein CICLE_v10021714mg [Citr... 57 3e-06 ref|XP_006442341.1| hypothetical protein CICLE_v10021714mg [Citr... 57 3e-06 ref|XP_002300458.2| hypothetical protein POPTR_0001s39200g [Popu... 55 8e-06 >ref|XP_006477817.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform X2 [Citrus sinensis] Length = 235 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 256 LNLQMLTGFKDAAGVAGNIFAFGLFLSPVPTFRRI 360 + Q LT KDA G+AGNIFAFGLF+SPVPTFRRI Sbjct: 5 ITYQALTVLKDAVGIAGNIFAFGLFVSPVPTFRRI 39 >ref|XP_006477816.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform X1 [Citrus sinensis] Length = 266 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 256 LNLQMLTGFKDAAGVAGNIFAFGLFLSPVPTFRRI 360 + Q LT KDA G+AGNIFAFGLF+SPVPTFRRI Sbjct: 5 ITYQALTVLKDAVGIAGNIFAFGLFVSPVPTFRRI 39 >ref|XP_006442343.1| hypothetical protein CICLE_v10021714mg [Citrus clementina] gi|557544605|gb|ESR55583.1| hypothetical protein CICLE_v10021714mg [Citrus clementina] Length = 191 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 256 LNLQMLTGFKDAAGVAGNIFAFGLFLSPVPTFRRI 360 + Q LT KDA G+AGNIFAFGLF+SPVPTFRRI Sbjct: 5 ITYQALTVLKDAVGIAGNIFAFGLFVSPVPTFRRI 39 >ref|XP_006442342.1| hypothetical protein CICLE_v10021714mg [Citrus clementina] gi|557544604|gb|ESR55582.1| hypothetical protein CICLE_v10021714mg [Citrus clementina] Length = 266 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 256 LNLQMLTGFKDAAGVAGNIFAFGLFLSPVPTFRRI 360 + Q LT KDA G+AGNIFAFGLF+SPVPTFRRI Sbjct: 5 ITYQALTVLKDAVGIAGNIFAFGLFVSPVPTFRRI 39 >ref|XP_006442341.1| hypothetical protein CICLE_v10021714mg [Citrus clementina] gi|557544603|gb|ESR55581.1| hypothetical protein CICLE_v10021714mg [Citrus clementina] Length = 235 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 256 LNLQMLTGFKDAAGVAGNIFAFGLFLSPVPTFRRI 360 + Q LT KDA G+AGNIFAFGLF+SPVPTFRRI Sbjct: 5 ITYQALTVLKDAVGIAGNIFAFGLFVSPVPTFRRI 39 >ref|XP_002300458.2| hypothetical protein POPTR_0001s39200g [Populus trichocarpa] gi|550349242|gb|EEE85263.2| hypothetical protein POPTR_0001s39200g [Populus trichocarpa] Length = 219 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +1 Query: 244 LMDNLNLQMLTGFKDAAGVAGNIFAFGLFLSPVPTFRRI 360 + D+++ + T KDAAG+AGNIFAFGLF+SP+PT+RRI Sbjct: 1 MSDSVHNPVWTSCKDAAGIAGNIFAFGLFVSPIPTYRRI 39