BLASTX nr result
ID: Mentha23_contig00033200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033200 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35379.1| hypothetical protein MIMGU_mgv1a000476mg [Mimulus... 77 2e-12 gb|EYU19354.1| hypothetical protein MIMGU_mgv1a000485mg [Mimulus... 75 7e-12 ref|NP_001234490.1| alternative transcript type 3 [Solanum lycop... 73 4e-11 sp|P33530.1|PHYA1_TOBAC RecName: Full=Phytochrome A1 gi|297478|e... 73 5e-11 gb|AGT50254.1| phytochrome A2 [Ipomoea batatas] 73 5e-11 gb|AGT50253.1| phytochrome A1 [Ipomoea batatas] 73 5e-11 ref|XP_006339917.1| PREDICTED: type A phytochrome [Solanum tuber... 72 6e-11 gb|AGT50255.1| phytochrome A3 [Ipomoea batatas] 72 6e-11 sp|P30733.2|PHYA_SOLTU RecName: Full=Phytochrome A gi|7550158|gb... 72 6e-11 gb|AAR08426.1| phytochrome A [Orobanche minor] 72 8e-11 gb|AAR08427.1| phytochrome A [Monotropastrum globosum] 72 8e-11 ref|XP_007031301.1| Phytochrome A [Theobroma cacao] gi|508719906... 71 1e-10 gb|AAO86644.1| PHYA3 photoreceptor [Stellaria longipes] 71 1e-10 gb|ACC60969.1| phytochrome A [Vitis riparia] 71 2e-10 ref|XP_002278610.1| PREDICTED: phytochrome A1 [Vitis vinifera] g... 71 2e-10 gb|AAO86643.1| PHYA2 photoreceptor [Stellaria longipes] 70 2e-10 gb|AAQ11871.1| phytochrome A1 [Stellaria longipes] 70 2e-10 gb|EXB57569.1| Phytochrome type A [Morus notabilis] 70 3e-10 ref|NP_001275384.1| phytochrome A [Solanum tuberosum] gi|7657416... 70 3e-10 ref|XP_002512596.1| phytochrome A, putative [Ricinus communis] g... 70 3e-10 >gb|EYU35379.1| hypothetical protein MIMGU_mgv1a000476mg [Mimulus guttatus] Length = 1129 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 +EGISLFISRKLVKLMNGDVQYLREAG+STFIIS+ELAIS+N+ Sbjct: 1087 DEGISLFISRKLVKLMNGDVQYLREAGKSTFIISVELAISNNN 1129 >gb|EYU19354.1| hypothetical protein MIMGU_mgv1a000485mg [Mimulus guttatus] Length = 1125 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNSQ 177 EEGI+LFISRKLVKLMNGDVQYLREAGRSTFI+++E+AISS Q Sbjct: 1081 EEGINLFISRKLVKLMNGDVQYLREAGRSTFIVTVEVAISSKPQ 1124 >ref|NP_001234490.1| alternative transcript type 3 [Solanum lycopersicum] gi|3492795|emb|CAA05086.1| phyA [Solanum lycopersicum] gi|3492797|emb|CAA05087.1| phyA [Solanum lycopersicum] gi|3492799|emb|CAA05088.1| phyA [Solanum lycopersicum] gi|3492801|emb|CAA05089.1| phyA [Solanum lycopersicum] Length = 1123 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 EEGISL +SRKLVKLMNG+VQYLREAG+STFIIS+ELA+++NS Sbjct: 1080 EEGISLLVSRKLVKLMNGEVQYLREAGQSTFIISVELAVATNS 1122 >sp|P33530.1|PHYA1_TOBAC RecName: Full=Phytochrome A1 gi|297478|emb|CAA47284.1| type-A phytochrome [Nicotiana tabacum] Length = 1124 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 EEGISL ISRKLVKLMNG+VQYLREAGRSTFIIS+ELA+++ S Sbjct: 1080 EEGISLLISRKLVKLMNGEVQYLREAGRSTFIISVELAVATKS 1122 >gb|AGT50254.1| phytochrome A2 [Ipomoea batatas] Length = 1127 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISS 186 E+GISL ISRKLVKLMNGDVQYLREAGRSTFIIS+ELA++S Sbjct: 1083 EDGISLLISRKLVKLMNGDVQYLREAGRSTFIISVELAVAS 1123 >gb|AGT50253.1| phytochrome A1 [Ipomoea batatas] Length = 1127 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISS 186 E+GISL ISRKLVKLMNGDVQYLREAGRSTFIIS+ELA++S Sbjct: 1083 EDGISLLISRKLVKLMNGDVQYLREAGRSTFIISVELAVAS 1123 >ref|XP_006339917.1| PREDICTED: type A phytochrome [Solanum tuberosum] Length = 1123 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 EEGISL +SRKLVKLMNG+VQYLREAGRSTFIIS+ELA+++ S Sbjct: 1080 EEGISLLVSRKLVKLMNGEVQYLREAGRSTFIISVELAVATKS 1122 >gb|AGT50255.1| phytochrome A3 [Ipomoea batatas] Length = 1127 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISS 186 E+GISL ISRKLVKLMNGD+QYLREAGRSTFIIS+ELA++S Sbjct: 1083 EDGISLLISRKLVKLMNGDIQYLREAGRSTFIISVELAVAS 1123 >sp|P30733.2|PHYA_SOLTU RecName: Full=Phytochrome A gi|7550158|gb|AAB21533.2| type A phytochrome [Solanum tuberosum] Length = 1123 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 EEGISL +SRKLVKLMNG+VQYLREAGRSTFIIS+ELA+++ S Sbjct: 1080 EEGISLLVSRKLVKLMNGEVQYLREAGRSTFIISVELAVATKS 1122 >gb|AAR08426.1| phytochrome A [Orobanche minor] Length = 1123 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISS 186 E+GISLFISRKLVKLM GD+QYLREAGRSTFIIS+E+AIS+ Sbjct: 1079 EDGISLFISRKLVKLMKGDIQYLREAGRSTFIISVEIAISN 1119 >gb|AAR08427.1| phytochrome A [Monotropastrum globosum] Length = 1130 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSN 183 EEGISL +SRKLVKLMNGDVQYLREAG+STFIIS+ELA ++N Sbjct: 1084 EEGISLLVSRKLVKLMNGDVQYLREAGKSTFIISVELAAAAN 1125 >ref|XP_007031301.1| Phytochrome A [Theobroma cacao] gi|508719906|gb|EOY11803.1| Phytochrome A [Theobroma cacao] Length = 1121 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNSQ 177 EEGISL ISRKLVKLMNGD+QYLREAGRSTFI+++ELA ++ S+ Sbjct: 1077 EEGISLLISRKLVKLMNGDIQYLREAGRSTFIVTVELAAANRSR 1120 >gb|AAO86644.1| PHYA3 photoreceptor [Stellaria longipes] Length = 1123 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 EEGISL +SRK+VKLMNGDVQYLR AG STFIIS+ELAI+ NS Sbjct: 1080 EEGISLLVSRKIVKLMNGDVQYLRSAGSSTFIISVELAIAGNS 1122 >gb|ACC60969.1| phytochrome A [Vitis riparia] Length = 1124 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNSQPMA 168 EEGISL ISRKLVKLMNGDVQYLREAG+STFIIS+ELA ++ +P A Sbjct: 1079 EEGISLLISRKLVKLMNGDVQYLREAGKSTFIISIELA-AARKKPQA 1124 >ref|XP_002278610.1| PREDICTED: phytochrome A1 [Vitis vinifera] gi|147838424|emb|CAN76586.1| hypothetical protein VITISV_020287 [Vitis vinifera] gi|183239014|gb|ACC60965.1| phytochrome A [Vitis vinifera] gi|296089871|emb|CBI39690.3| unnamed protein product [Vitis vinifera] Length = 1124 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNSQPMA 168 EEGISL ISRKLVKLMNGDVQYLREAG+STFIIS+ELA ++ +P A Sbjct: 1079 EEGISLLISRKLVKLMNGDVQYLREAGKSTFIISIELA-AARKKPQA 1124 >gb|AAO86643.1| PHYA2 photoreceptor [Stellaria longipes] Length = 935 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 E+GISL ISRKLVKLMNGD+QYLR AG STFIIS+ELA++ NS Sbjct: 892 EDGISLLISRKLVKLMNGDIQYLRSAGTSTFIISVELAVAGNS 934 >gb|AAQ11871.1| phytochrome A1 [Stellaria longipes] Length = 1122 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 E+GISL ISRKLVKLMNGD+QYLR AG STFIIS+ELA++ NS Sbjct: 1079 EDGISLLISRKLVKLMNGDIQYLRSAGTSTFIISVELAVAGNS 1121 >gb|EXB57569.1| Phytochrome type A [Morus notabilis] Length = 1130 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNSQ 177 EEGISL ISRKLVKLMNGDVQYL+EAG+STFIIS+ELA + S+ Sbjct: 1080 EEGISLLISRKLVKLMNGDVQYLKEAGKSTFIISVELAAAHKSR 1123 >ref|NP_001275384.1| phytochrome A [Solanum tuberosum] gi|76574169|gb|ABA46868.1| phytochrome A [Solanum tuberosum] Length = 1123 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNS 180 EEGI L +SRKLVKLMNG+VQYLREAGRSTFIIS+ELA+++ S Sbjct: 1080 EEGIFLLVSRKLVKLMNGEVQYLREAGRSTFIISVELAVATKS 1122 >ref|XP_002512596.1| phytochrome A, putative [Ricinus communis] gi|223548557|gb|EEF50048.1| phytochrome A, putative [Ricinus communis] Length = 1124 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -1 Query: 308 EEGISLFISRKLVKLMNGDVQYLREAGRSTFIISLELAISSNSQ 177 +EG+SLFISRKLVKLMNGDVQYLREAG+S+FI+++ELA SQ Sbjct: 1080 DEGVSLFISRKLVKLMNGDVQYLREAGKSSFIVTVELAAGRKSQ 1123