BLASTX nr result
ID: Mentha23_contig00033182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033182 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41198.1| hypothetical protein MIMGU_mgv1a000816mg [Mimulus... 60 3e-07 >gb|EYU41198.1| hypothetical protein MIMGU_mgv1a000816mg [Mimulus guttatus] Length = 975 Score = 60.1 bits (144), Expect = 3e-07 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Frame = -2 Query: 233 SSLNGQIVKDNNNSLVDNGAQAPKGRAKPK-QSRKNTKQSQLSSIAASTEAAEVPDSSKK 57 S LNGQIVKD+ SLV Q PKG+ K K QSR KQ+Q A + + +++P + K Sbjct: 83 SPLNGQIVKDSEKSLVGKNIQTPKGKEKAKPQSRSKKKQTQ---SAVADDTSDMPINPVK 139 Query: 56 ITGAKETTKSNSKQSHIS 3 I+ AKET + SK++ IS Sbjct: 140 ISQAKETKNNKSKKTPIS 157