BLASTX nr result
ID: Mentha23_contig00033134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00033134 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69584.1| hypothetical protein M569_05182, partial [Genlise... 60 2e-07 ref|XP_002513587.1| RNA polymerase sigma factor rpoD, putative [... 59 7e-07 gb|EYU19623.1| hypothetical protein MIMGU_mgv1a020453mg [Mimulus... 59 9e-07 ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD ... 59 9e-07 gb|EYU25198.1| hypothetical protein MIMGU_mgv1a004656mg [Mimulus... 58 1e-06 ref|XP_006847349.1| hypothetical protein AMTR_s00015p00252960 [A... 57 2e-06 ref|XP_004308009.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 2e-06 ref|XP_007038959.1| Sigma factor E isoform 1 [Theobroma cacao] g... 57 3e-06 ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prun... 57 3e-06 ref|XP_004166500.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 4e-06 ref|XP_004149458.1| PREDICTED: RNA polymerase sigma factor sigE,... 57 4e-06 gb|EXB72455.1| RNA polymerase sigma factor rpoD [Morus notabilis] 56 5e-06 ref|XP_006350582.1| PREDICTED: RNA polymerase sigma factor sigE,... 56 6e-06 ref|XP_007161346.1| hypothetical protein PHAVU_001G061400g [Phas... 56 6e-06 ref|XP_004234180.1| PREDICTED: RNA polymerase sigma factor sigE,... 56 6e-06 ref|XP_004234179.1| PREDICTED: RNA polymerase sigma factor sigE,... 56 6e-06 ref|NP_001254001.1| RNA polymerase sigma factor rpoD-like [Glyci... 56 6e-06 ref|XP_006376620.1| RNA polymerase sigma subunit SigE family pro... 55 8e-06 gb|EMT05926.1| RNA polymerase sigma factor rpoD [Aegilops tauschii] 55 8e-06 gb|EMS53739.1| RNA polymerase sigma factor rpoD [Triticum urartu] 55 8e-06 >gb|EPS69584.1| hypothetical protein M569_05182, partial [Genlisea aurea] Length = 488 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIYK 95 SREMVRK+EVKALMKLKHPARVDYLR YI+K Sbjct: 458 SREMVRKHEVKALMKLKHPARVDYLRRYIFK 488 >ref|XP_002513587.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] gi|223547495|gb|EEF48990.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis] Length = 501 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRKYEVKALMKLKHPARVDYLR Y+ Sbjct: 472 SREMVRKYEVKALMKLKHPARVDYLRRYV 500 >gb|EYU19623.1| hypothetical protein MIMGU_mgv1a020453mg [Mimulus guttatus] Length = 515 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIYK 95 SREMVRKYEVKALMKLKH ARVDYLR Y++K Sbjct: 485 SREMVRKYEVKALMKLKHRARVDYLRRYVFK 515 >ref|XP_002268709.1| PREDICTED: RNA polymerase sigma factor rpoD [Vitis vinifera] gi|302143685|emb|CBI22546.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIY 92 SREMVRK+EVKALMKLKHPARVDYLR YI+ Sbjct: 489 SREMVRKHEVKALMKLKHPARVDYLRQYIF 518 >gb|EYU25198.1| hypothetical protein MIMGU_mgv1a004656mg [Mimulus guttatus] Length = 516 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIYK 95 SREMVRK+EVKA MKLKHPARVDYLRH+I K Sbjct: 486 SREMVRKHEVKAFMKLKHPARVDYLRHHISK 516 >ref|XP_006847349.1| hypothetical protein AMTR_s00015p00252960 [Amborella trichopoda] gi|548850426|gb|ERN08930.1| hypothetical protein AMTR_s00015p00252960 [Amborella trichopoda] Length = 128 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR YI Sbjct: 99 SREMVRKHEVKALMKLKHPARVDYLRRYI 127 >ref|XP_004308009.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Fragaria vesca subsp. vesca] Length = 520 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR YI Sbjct: 491 SREMVRKHEVKALMKLKHPARVDYLRRYI 519 >ref|XP_007038959.1| Sigma factor E isoform 1 [Theobroma cacao] gi|590673674|ref|XP_007038960.1| Sigma factor E isoform 1 [Theobroma cacao] gi|508776204|gb|EOY23460.1| Sigma factor E isoform 1 [Theobroma cacao] gi|508776205|gb|EOY23461.1| Sigma factor E isoform 1 [Theobroma cacao] Length = 516 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR Y+ Sbjct: 487 SREMVRKHEVKALMKLKHPARVDYLRRYV 515 >ref|XP_007219010.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] gi|462415472|gb|EMJ20209.1| hypothetical protein PRUPE_ppa004259mg [Prunus persica] Length = 519 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR Y+ Sbjct: 490 SREMVRKHEVKALMKLKHPARVDYLRRYV 518 >ref|XP_004166500.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 515 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR Y+ Sbjct: 486 SREMVRKHEVKALMKLKHPARVDYLRRYL 514 >ref|XP_004149458.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Cucumis sativus] Length = 514 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR Y+ Sbjct: 485 SREMVRKHEVKALMKLKHPARVDYLRRYL 513 >gb|EXB72455.1| RNA polymerase sigma factor rpoD [Morus notabilis] Length = 517 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPARVDYLR Y+ Sbjct: 488 SREMVRKHEVKALMKLKHPARVDYLRRYM 516 >ref|XP_006350582.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like [Solanum tuberosum] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIY 92 SREMVRK+EVKALMKLKHP RVDY+R YI+ Sbjct: 487 SREMVRKHEVKALMKLKHPTRVDYVRRYIF 516 >ref|XP_007161346.1| hypothetical protein PHAVU_001G061400g [Phaseolus vulgaris] gi|561034810|gb|ESW33340.1| hypothetical protein PHAVU_001G061400g [Phaseolus vulgaris] Length = 511 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPAR+DYLR Y+ Sbjct: 482 SREMVRKHEVKALMKLKHPARLDYLRRYV 510 >ref|XP_004234180.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 487 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIY 92 SREMVRK+EVKALMKLKHP RVDY+R YI+ Sbjct: 458 SREMVRKHEVKALMKLKHPTRVDYVRRYIF 487 >ref|XP_004234179.1| PREDICTED: RNA polymerase sigma factor sigE, chloroplastic/mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 516 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYIY 92 SREMVRK+EVKALMKLKHP RVDY+R YI+ Sbjct: 487 SREMVRKHEVKALMKLKHPTRVDYVRRYIF 516 >ref|NP_001254001.1| RNA polymerase sigma factor rpoD-like [Glycine max] gi|382365028|dbj|BAM05477.1| sigma-like factor 5A [Glycine max] Length = 512 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHPAR+DYLR Y+ Sbjct: 483 SREMVRKHEVKALMKLKHPARLDYLRRYV 511 >ref|XP_006376620.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] gi|550326141|gb|ERP54417.1| RNA polymerase sigma subunit SigE family protein [Populus trichocarpa] Length = 512 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRK+EVKALMKLKHP RVDYLR Y+ Sbjct: 483 SREMVRKHEVKALMKLKHPTRVDYLRRYV 511 >gb|EMT05926.1| RNA polymerase sigma factor rpoD [Aegilops tauschii] Length = 351 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRKYE+KALMKLKHP RVDYLR Y+ Sbjct: 323 SREMVRKYELKALMKLKHPTRVDYLRRYM 351 >gb|EMS53739.1| RNA polymerase sigma factor rpoD [Triticum urartu] Length = 418 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 3 SREMVRKYEVKALMKLKHPARVDYLRHYI 89 SREMVRKYE+KALMKLKHP RVDYLR Y+ Sbjct: 390 SREMVRKYELKALMKLKHPTRVDYLRRYM 418