BLASTX nr result
ID: Mentha23_contig00013578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00013578 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66196.1| hypothetical protein M569_08583, partial [Genlise... 60 4e-07 ref|XP_007030936.1| Mog1/PsbP/DUF1795-like photosystem II reacti... 57 3e-06 gb|EXC31825.1| hypothetical protein L484_020653 [Morus notabilis] 56 6e-06 >gb|EPS66196.1| hypothetical protein M569_08583, partial [Genlisea aurea] Length = 186 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 AIIAGATAPQKKWDDDGVRLRSAAVSLTVL 92 AIIAGATAPQKKWD+DGVRLRSAAVSLTVL Sbjct: 157 AIIAGATAPQKKWDEDGVRLRSAAVSLTVL 186 >ref|XP_007030936.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein isoform 1 [Theobroma cacao] gi|508719541|gb|EOY11438.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein isoform 1 [Theobroma cacao] Length = 253 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 AIIAGATAPQKKWDDDGVRLRSAAVSLTVL 92 A+IAGATAPQ KWDDDGV+LRSAA+SLTVL Sbjct: 224 AVIAGATAPQSKWDDDGVKLRSAALSLTVL 253 >gb|EXC31825.1| hypothetical protein L484_020653 [Morus notabilis] Length = 248 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 AIIAGATAPQKKWDDDGVRLRSAAVSLTVL 92 AIIAGATAPQ KWDDDG++LRSAA+S+TVL Sbjct: 219 AIIAGATAPQSKWDDDGMKLRSAAISMTVL 248