BLASTX nr result
ID: Mentha23_contig00009345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00009345 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265308.1| PREDICTED: lysine histidine transporter 1 [V... 56 6e-06 gb|EXC31371.1| hypothetical protein L484_017652 [Morus notabilis] 55 8e-06 >ref|XP_002265308.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera] gi|296090261|emb|CBI40080.3| unnamed protein product [Vitis vinifera] Length = 442 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 460 CIVLGVLLMVIAPIGALRLIILQAKTYEFYS 368 CI+LG+LLM++APIGALR IIL+AKTYEFYS Sbjct: 412 CIILGLLLMILAPIGALRNIILEAKTYEFYS 442 >gb|EXC31371.1| hypothetical protein L484_017652 [Morus notabilis] Length = 448 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 460 CIVLGVLLMVIAPIGALRLIILQAKTYEFYS 368 CIVLGVLLM+++PIG LR II+QAKTYEFYS Sbjct: 418 CIVLGVLLMILSPIGGLRQIIIQAKTYEFYS 448