BLASTX nr result
ID: Mentha23_contig00007586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00007586 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44416.1| hypothetical protein MIMGU_mgv1a011890mg [Mimulus... 61 2e-07 ref|NP_201515.1| F-box/RNI-like superfamily protein [Arabidopsis... 56 5e-06 ref|XP_002865025.1| F-box family protein [Arabidopsis lyrata sub... 56 5e-06 >gb|EYU44416.1| hypothetical protein MIMGU_mgv1a011890mg [Mimulus guttatus] Length = 267 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +2 Query: 2 WGMRVPLDCFVGLLTISPALQIRPKEILLHEENLHAWPVY 121 WGMRVPLD +GLLTISPALQI+PK +LL + WP+Y Sbjct: 228 WGMRVPLDSIIGLLTISPALQIQPKGMLLPDHAYQGWPIY 267 >ref|NP_201515.1| F-box/RNI-like superfamily protein [Arabidopsis thaliana] gi|75262475|sp|Q9FH99.1|FB302_ARATH RecName: Full=F-box protein At5g67140 gi|10177601|dbj|BAB10948.1| unnamed protein product [Arabidopsis thaliana] gi|18252175|gb|AAL61920.1| unknown protein [Arabidopsis thaliana] gi|21386939|gb|AAM47873.1| unknown protein [Arabidopsis thaliana] gi|332010923|gb|AED98306.1| F-box/RNI-like superfamily protein [Arabidopsis thaliana] Length = 228 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 4/40 (10%) Frame = +2 Query: 2 WGMRVPLDCFVGLLTISPALQIRPKEILLHEEN----LHA 109 WG RVP+DCF+ LLTISPALQI+P E+LL+ +N LHA Sbjct: 188 WGTRVPVDCFIALLTISPALQIKPMELLLNAQNPPPLLHA 227 >ref|XP_002865025.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297310860|gb|EFH41284.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 228 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 4/40 (10%) Frame = +2 Query: 2 WGMRVPLDCFVGLLTISPALQIRPKEILLHEEN----LHA 109 WG RVP+DCF+ LLTISPALQI+P E+LL+ +N LHA Sbjct: 188 WGTRVPVDCFIALLTISPALQIKPMELLLNAQNPPPLLHA 227