BLASTX nr result
ID: Mentha23_contig00004518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha23_contig00004518 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 63 5e-08 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/85 (40%), Positives = 49/85 (57%) Frame = -3 Query: 415 DLWIMKKGWWINTSVFSTCGIQSPVCFSKSGRLLYFESMNDELLVFDRATGKLKQLGIYC 236 DLW+M W S+ S G++ P+ F K+G L + ES N EL++FD AT +LK LGI+ Sbjct: 290 DLWVMNGSWTRQFSIESVSGVERPLGFWKNGEL-FLESSNHELVLFDPATRELKNLGIHA 348 Query: 235 FSNRIKFHPVFESSFHLYGVSYVEE 161 + N ++ ES + G S EE Sbjct: 349 YQNTMQLIAYVESLVPINGRSEQEE 373