BLASTX nr result
ID: Mentha22_contig00053288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00053288 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 60 2e-07 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 60.5 bits (145), Expect = 2e-07 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 13/130 (10%) Frame = -1 Query: 399 YKVVRSFVEYHQD-----GYA--FKRADLYSLETASLKPIPIEKEHSIISSVCRGVYIRG 241 YKVVR Y + G A + +LYSL++ S K I + + H S + Y+ G Sbjct: 167 YKVVRFVTNYFDENEEEGGLADWIHQVELYSLKSDSWKEISVPEAHPYASPLFNN-YVNG 225 Query: 240 KYYWARSS----VIECFDFTDETFSVIPQPPKPYGCRFTNYYVILVECHGDLGLILCP-- 79 YYW + +I FD +E FS +P P +G YY+ L++ +G LG I+ P Sbjct: 226 SYYWQATGNSDYLILSFDMANEKFSTLPLP--TFGGSLAQYYLQLLDFNGSLGAIVYPRE 283 Query: 78 GVLEHCELWM 49 G + +LW+ Sbjct: 284 GTEKSIDLWV 293