BLASTX nr result
ID: Mentha22_contig00053198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00053198 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75909.1| hypothetical protein VITISV_023994 [Vitis vinifera] 57 3e-06 ref|XP_006366528.1| PREDICTED: uncharacterized protein LOC102589... 56 5e-06 >emb|CAN75909.1| hypothetical protein VITISV_023994 [Vitis vinifera] Length = 126 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +1 Query: 217 YIHPSDNPGTILVAELLCGSNYVNWSRSMKTALLAKN 327 Y+HPSDNPG +LV+E+ G NY+ WSRSM AL KN Sbjct: 31 YLHPSDNPGALLVSEIFTGENYIAWSRSMSIALTVKN 67 >ref|XP_006366528.1| PREDICTED: uncharacterized protein LOC102589874 [Solanum tuberosum] Length = 400 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +1 Query: 214 LYIHPSDNPGTILVAELLCG-SNYVNWSRSMKTALLAKN 327 LY+HPSD PG+ILV++ L G NY+ WS SMK ALLAKN Sbjct: 31 LYLHPSDTPGSILVSQQLTGIENYIGWSNSMKVALLAKN 69