BLASTX nr result
ID: Mentha22_contig00052977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00052977 (530 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001066977.2| Os12g0550700 [Oryza sativa Japonica Group] g... 60 3e-07 gb|ABA93883.1| transposon protein, putative, Pong sub-class, exp... 60 3e-07 gb|EEE67457.1| hypothetical protein OsJ_24845 [Oryza sativa Japo... 60 3e-07 gb|EEE53382.1| hypothetical protein OsJ_36428 [Oryza sativa Japo... 60 3e-07 gb|EMS54214.1| hypothetical protein TRIUR3_32818 [Triticum urartu] 60 4e-07 gb|ETP26605.1| hypothetical protein F441_00767 [Phytophthora par... 59 5e-07 gb|ETO85584.1| hypothetical protein F444_00781 [Phytophthora par... 59 5e-07 gb|ETN24251.1| hypothetical protein PPTG_20770 [Phytophthora par... 59 5e-07 gb|ETI56849.1| hypothetical protein F443_00779 [Phytophthora par... 59 5e-07 gb|ABD64939.1| hypothetical protein 24.t00017 [Brassica oleracea] 59 7e-07 ref|XP_002999074.1| conserved hypothetical protein [Phytophthora... 59 7e-07 ref|XP_002898566.1| conserved hypothetical protein [Phytophthora... 59 7e-07 ref|XP_002896159.1| conserved hypothetical protein [Phytophthora... 59 7e-07 ref|XP_002450816.1| hypothetical protein SORBIDRAFT_05g019020 [S... 59 9e-07 ref|XP_006644733.1| PREDICTED: uncharacterized protein LOC102699... 58 2e-06 ref|XP_003581437.1| PREDICTED: uncharacterized protein LOC100824... 57 2e-06 ref|XP_003572311.1| PREDICTED: uncharacterized protein LOC100841... 57 2e-06 ref|XP_006651684.1| PREDICTED: uncharacterized protein LOC102716... 57 3e-06 gb|ETP21583.1| hypothetical protein F441_04929 [Phytophthora par... 57 3e-06 gb|EMS61217.1| hypothetical protein TRIUR3_16734 [Triticum urartu] 57 3e-06 >ref|NP_001066977.2| Os12g0550700 [Oryza sativa Japonica Group] gi|77556104|gb|ABA98900.1| transposon protein, putative, Pong sub-class [Oryza sativa Japonica Group] gi|255670382|dbj|BAF29996.2| Os12g0550700 [Oryza sativa Japonica Group] Length = 446 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 P+F + V+ G AP++QFT NG YNM YYLADGIYP+W F+ S Sbjct: 269 PLF--TEVLQGRAPTVQFTVNGSDYNMGYYLADGIYPEWAAFVKS 311 >gb|ABA93883.1| transposon protein, putative, Pong sub-class, expressed [Oryza sativa Japonica Group] gi|222616039|gb|EEE52171.1| hypothetical protein OsJ_34031 [Oryza sativa Japonica Group] Length = 448 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPT 518 P+F +AV+ G APS+QFT NG YNM YYLAD IYP+W F S T Sbjct: 269 PLF--TAVLQGRAPSVQFTVNGTEYNMGYYLADNIYPEWAAFAKSIT 313 >gb|EEE67457.1| hypothetical protein OsJ_24845 [Oryza sativa Japonica Group] Length = 452 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPT 518 P+F +AV+ G APS+QFT NG YNM YYLAD IYP+W F S T Sbjct: 273 PLF--TAVLQGRAPSVQFTVNGTEYNMGYYLADNIYPEWAAFAKSIT 317 >gb|EEE53382.1| hypothetical protein OsJ_36428 [Oryza sativa Japonica Group] Length = 414 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 P+F + V+ G AP++QFT NG YNM YYLADGIYP+W F+ S Sbjct: 237 PLF--TEVLQGRAPTVQFTVNGSDYNMGYYLADGIYPEWAAFVKS 279 >gb|EMS54214.1| hypothetical protein TRIUR3_32818 [Triticum urartu] Length = 626 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = +3 Query: 387 ISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFI 506 + S + NG P +QF ANGR YN YYLADGIYPKW F+ Sbjct: 48 LMSKIANGELPPVQFVANGRTYNYGYYLADGIYPKWQTFV 87 >gb|ETP26605.1| hypothetical protein F441_00767 [Phytophthora parasitica CJ01A1] Length = 373 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 204 LVNGVAPKISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 244 >gb|ETO85584.1| hypothetical protein F444_00781 [Phytophthora parasitica P1976] Length = 189 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 20 LVNGVAPKISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 60 >gb|ETN24251.1| hypothetical protein PPTG_20770 [Phytophthora parasitica INRA-310] Length = 243 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 75 LVNGVAPKISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 115 >gb|ETI56849.1| hypothetical protein F443_00779 [Phytophthora parasitica P1569] Length = 353 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 184 LVNGVAPKISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 224 >gb|ABD64939.1| hypothetical protein 24.t00017 [Brassica oleracea] Length = 442 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 PVF ++NG AP + ++ NGR Y++AYYL DGIYPKW FI S Sbjct: 260 PVF--DDIINGQAPQVTYSVNGREYHLAYYLTDGIYPKWATFIQS 302 >ref|XP_002999074.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262111168|gb|EEY69220.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 365 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 196 LVNGVAPRISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 236 >ref|XP_002898566.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262104991|gb|EEY63043.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 211 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 70 LVNGVAPRISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 110 >ref|XP_002896159.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|301101086|ref|XP_002899632.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262094935|gb|EEY52987.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262103940|gb|EEY61992.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 211 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YYL DGIYP W +F SS +A Sbjct: 70 LVNGVAPRISFTVNGATYNQGYYLTDGIYPAWAIFQSSISA 110 >ref|XP_002450816.1| hypothetical protein SORBIDRAFT_05g019020 [Sorghum bicolor] gi|241936659|gb|EES09804.1| hypothetical protein SORBIDRAFT_05g019020 [Sorghum bicolor] Length = 226 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 P+FI + + G AP +QF+ NGR YN YYLADGIYP+W F+ S Sbjct: 173 PLFIEA--LKGQAPQVQFSVNGRQYNTGYYLADGIYPEWAAFVKS 215 >ref|XP_006644733.1| PREDICTED: uncharacterized protein LOC102699821 [Oryza brachyantha] gi|573940906|ref|XP_006652852.1| PREDICTED: uncharacterized protein LOC102711968 [Oryza brachyantha] Length = 450 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPT 518 P+F + ++ G AP +QFT NG YNM YYLADGIYP+W F S T Sbjct: 273 PLF--TEMIQGRAPPVQFTINGTQYNMGYYLADGIYPEWAAFAKSIT 317 >ref|XP_003581437.1| PREDICTED: uncharacterized protein LOC100824964 [Brachypodium distachyon] Length = 448 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 P+F + V+ G AP ++FT NGR Y+M YYL DGIYP+W F+ S Sbjct: 269 PLF--TTVLQGRAPPVEFTVNGRQYDMGYYLVDGIYPEWAAFVKS 311 >ref|XP_003572311.1| PREDICTED: uncharacterized protein LOC100841549 [Brachypodium distachyon] Length = 294 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 PVF + A G AP + +T NGR YNM YYLADGIYP+W F+ + Sbjct: 172 PVFANLA--KGHAPEVNYTINGRNYNMGYYLADGIYPRWATFVKT 214 >ref|XP_006651684.1| PREDICTED: uncharacterized protein LOC102716308 [Oryza brachyantha] gi|573946297|ref|XP_006655482.1| PREDICTED: uncharacterized protein LOC102722401 [Oryza brachyantha] gi|573960409|ref|XP_006662388.1| PREDICTED: uncharacterized protein LOC102722616 [Oryza brachyantha] Length = 451 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 378 PVFISSAVVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISS 512 P+F + VV G AP + FT NG YN+ YYLADGIYP+W F+ + Sbjct: 267 PLF--TEVVQGRAPEVHFTVNGNEYNLGYYLADGIYPEWATFVKT 309 >gb|ETP21583.1| hypothetical protein F441_04929 [Phytophthora parasitica CJ01A1] Length = 384 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 399 VVNGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFISSPTA 521 +VNG+AP I FT NG YN YY +DGIYP W +F SS +A Sbjct: 215 LVNGVAPKISFTVNGATYNQGYYHSDGIYPAWAIFQSSISA 255 >gb|EMS61217.1| hypothetical protein TRIUR3_16734 [Triticum urartu] Length = 634 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +3 Query: 405 NGIAPSIQFTANGRPYNMAYYLADGIYPKWPVFI 506 NG APS+ F ANGR YN YYLADGIYP+W F+ Sbjct: 585 NGEAPSVTFEANGRTYNYGYYLADGIYPRWSTFV 618