BLASTX nr result
ID: Mentha22_contig00052901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00052901 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213493.1| hypothetical protein PRUPE_ppa022346mg, part... 60 3e-07 >ref|XP_007213493.1| hypothetical protein PRUPE_ppa022346mg, partial [Prunus persica] gi|462409358|gb|EMJ14692.1| hypothetical protein PRUPE_ppa022346mg, partial [Prunus persica] Length = 364 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/58 (44%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 141 KSEKPRRAWTLKEDEILIQAMKDLVIQG-WKSENGFRNGYLGRLEDAFKKKMPGTDLQ 311 ++ K + WT ED L++A+ +L + G WK +NGFR+GYLG+LE A ++K+PG L+ Sbjct: 173 RNRKDKHIWTPIEDAFLVEALNELCVGGCWKVDNGFRSGYLGQLEKAMEQKLPGCGLK 230