BLASTX nr result
ID: Mentha22_contig00052760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00052760 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29612.1| hypothetical protein MIMGU_mgv1a000338mg [Mimulus... 75 9e-12 >gb|EYU29612.1| hypothetical protein MIMGU_mgv1a000338mg [Mimulus guttatus] Length = 1237 Score = 75.1 bits (183), Expect = 9e-12 Identities = 46/112 (41%), Positives = 66/112 (58%) Frame = +2 Query: 65 SEKPEQIMVPKSPLLDSNDHVEECPLENNSQHRDNNDHSNQKSNELEPDSQKLAVNESVF 244 +EKPEQ V L DS+ VEEC + N+Q Q SN+++ D + AVN S Sbjct: 631 TEKPEQREVFNRSLFDSDGPVEECEVVVNNQP------ICQTSNDIKLDYKNFAVNGSAL 684 Query: 245 DLFGTQGDQEKDLAVSTKEKSDFEYLLCKDIGTTESISTFGSEESKLENEEK 400 D G G+Q+ DL+ S K++S+FE + K+IGT++S STF S S+L + K Sbjct: 685 DFSGRYGEQDGDLSRSIKQQSNFESMPSKNIGTSDSTSTFKSMASELTKDPK 736