BLASTX nr result
ID: Mentha22_contig00051930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00051930 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007225002.1| hypothetical protein PRUPE_ppa020409mg, part... 57 2e-06 >ref|XP_007225002.1| hypothetical protein PRUPE_ppa020409mg, partial [Prunus persica] gi|462421938|gb|EMJ26201.1| hypothetical protein PRUPE_ppa020409mg, partial [Prunus persica] Length = 372 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +3 Query: 3 KINSRVKGESFSVSKIWLWSKKGKFPHSTAAHY-SNDINASLP 128 KINS KGESFSVSKIWLW KKGKFP+S+ H ++ + LP Sbjct: 322 KINSGSKGESFSVSKIWLWPKKGKFPNSSETHMGASSVTVGLP 364