BLASTX nr result
ID: Mentha22_contig00051157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00051157 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44778.1| hypothetical protein MIMGU_mgv1a008498mg [Mimulus... 62 1e-07 >gb|EYU44778.1| hypothetical protein MIMGU_mgv1a008498mg [Mimulus guttatus] Length = 371 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 248 MKRRSNSGKFHHRWKRKFLAFLLIAICFATFLLMESEYSK 367 MKRRS+ KFHHRW+RKF A LL C ATFLLME+E+S+ Sbjct: 1 MKRRSSLQKFHHRWRRKFFALLLFLFCVATFLLMEAEHSR 40