BLASTX nr result
ID: Mentha22_contig00050719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050719 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72545.1| hypothetical protein M569_02213, partial [Genlise... 61 2e-07 gb|EPS62783.1| retrotransposon protein, partial [Genlisea aurea] 61 2e-07 ref|XP_003575915.1| PREDICTED: putative nuclease HARBI1-like [Br... 59 5e-07 >gb|EPS72545.1| hypothetical protein M569_02213, partial [Genlisea aurea] Length = 372 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +1 Query: 253 GFLTPYKSVRYHLKEWGPNCSTPQNPKELFNMRH 354 GFLTPY+ VRYHL+EWGP PQN KE FNM+H Sbjct: 244 GFLTPYRGVRYHLREWGPGMQGPQNAKEYFNMKH 277 >gb|EPS62783.1| retrotransposon protein, partial [Genlisea aurea] Length = 291 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +1 Query: 253 GFLTPYKSVRYHLKEWGPNCSTPQNPKELFNMRH 354 GFL PY+ VRYHLKEWGP PQN KE FNM+H Sbjct: 156 GFLAPYRGVRYHLKEWGPGMQAPQNAKEYFNMKH 189 >ref|XP_003575915.1| PREDICTED: putative nuclease HARBI1-like [Brachypodium distachyon] Length = 393 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 253 GFLTPYKSVRYHLKEWGPNCSTPQNPKELFNMRH 354 GFL PY+SVRYHLKEW N + PQ P+EL+N+RH Sbjct: 262 GFLAPYRSVRYHLKEWAANGNNPQTPRELYNLRH 295