BLASTX nr result
ID: Mentha22_contig00050622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050622 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_003797024.1| hypothetical protein [Actinomyces odontolyti... 56 6e-06 >ref|WP_003797024.1| hypothetical protein [Actinomyces odontolyticus] gi|292819855|gb|EFF78860.1| hypothetical protein HMPREF0970_02232 [Actinomyces odontolyticus F0309] Length = 107 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = +1 Query: 112 DVKDKADKLAHDTKVAAKDLSAKAEHGAWVAKDKIEQGAWVAKDKAEHLAHDTKMAAKDL 291 + KDK +LA D K A+D K E AKDK+E+ A AKDKAE +A D K A+D+ Sbjct: 42 EAKDKLAELAGDAKDKAEDAKDKVEEATEDAKDKVEEAAEDAKDKAEEIAEDAKDKAEDI 101 Query: 292 SAKVE 306 K+E Sbjct: 102 KDKLE 106