BLASTX nr result
ID: Mentha22_contig00050433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050433 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32324.1| hypothetical protein MIMGU_mgv1a000960mg [Mimulus... 57 3e-06 >gb|EYU32324.1| hypothetical protein MIMGU_mgv1a000960mg [Mimulus guttatus] Length = 166 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 7/55 (12%) Frame = -2 Query: 161 MRICCFPFLCFGEGEIDNNM----DSHY---SVEEKDTMEEGDLGKENEGVENDD 18 M+ICCFPFLCFG GE DNN+ D+ Y S E K++ EG LG E+E +E DD Sbjct: 1 MKICCFPFLCFGIGEEDNNICSGRDTCYLLCSSEGKESTREGILGNESEEMEQDD 55