BLASTX nr result
ID: Mentha22_contig00050361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050361 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial... 61 2e-07 >gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Mimulus guttatus] Length = 727 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 343 IDTLEMIELYSCGRSAVSSAKRILEEQRGMGNNDIEVRINL 221 I TL+MIE+YSC S VSSAKRI EEQ+ GN+D+EVRINL Sbjct: 664 IPTLQMIEIYSCAHSVVSSAKRIQEEQQSYGNDDLEVRINL 704