BLASTX nr result
ID: Mentha22_contig00050197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050197 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610270.1| hypothetical protein MTR_4g130370 [Medicago ... 56 6e-06 gb|EXC30161.1| Autophagy-related protein 11 [Morus notabilis] 55 1e-05 >ref|XP_003610270.1| hypothetical protein MTR_4g130370 [Medicago truncatula] gi|355511325|gb|AES92467.1| hypothetical protein MTR_4g130370 [Medicago truncatula] Length = 1154 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/52 (55%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +2 Query: 17 STPDEGKNESGNKEST--LDQDRGSTP-PYGLPFGCEYFVVTVAMLPEIGVR 163 S P+ G+ + +K +T L + GSTP PYGLP GCEYFVVTVAMLP+ +R Sbjct: 1097 SLPEHGRATTPDKGTTDWLTLNSGSTPNPYGLPVGCEYFVVTVAMLPDTAIR 1148 >gb|EXC30161.1| Autophagy-related protein 11 [Morus notabilis] Length = 1154 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = +2 Query: 5 PPPSSTPDEGKNESGNKESTLDQDRGSTPPYGLPFGCEYFVVTVAMLPEIGV 160 P PS +++G TL+ S+ PYGLP GCEYFVVTVAMLP+ + Sbjct: 1095 PVPSGPEHNPASDTGTDRLTLNSGSTSSNPYGLPIGCEYFVVTVAMLPDTAI 1146