BLASTX nr result
ID: Mentha22_contig00050155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050155 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33445.1| hypothetical protein MIMGU_mgv1a005903mg [Mimulus... 60 3e-07 >gb|EYU33445.1| hypothetical protein MIMGU_mgv1a005903mg [Mimulus guttatus] Length = 465 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +2 Query: 134 WNGKWDWENLIAFGSKVIESPKNLQLADWTMV 229 WN KWDWEN++AFGSK ESPK LQL DW +V Sbjct: 3 WNAKWDWENIVAFGSKASESPKKLQLVDWMIV 34