BLASTX nr result
ID: Mentha22_contig00050062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00050062 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADV03080.1| farnesyl diphosphate synthase [Bacopa monnieri] 46 5e-06 gb|EYU23650.1| hypothetical protein MIMGU_mgv1a026653mg, partial... 45 9e-06 >gb|ADV03080.1| farnesyl diphosphate synthase [Bacopa monnieri] Length = 349 Score = 45.8 bits (107), Expect(2) = 5e-06 Identities = 16/28 (57%), Positives = 27/28 (96%) Frame = -2 Query: 171 SVILAGENLDNHKNVRDMVLDIGLYFQI 88 ++++AGENLDNH NV+D+++D+G+YFQ+ Sbjct: 210 ALLMAGENLDNHVNVKDVLIDMGIYFQV 237 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 218 HHHIVQYKTSIYSCYLPL 165 H IVQYKT+ YS YLP+ Sbjct: 190 HRRIVQYKTAYYSFYLPV 207 >gb|EYU23650.1| hypothetical protein MIMGU_mgv1a026653mg, partial [Mimulus guttatus] Length = 141 Score = 45.1 bits (105), Expect(2) = 9e-06 Identities = 17/36 (47%), Positives = 31/36 (86%) Frame = -2 Query: 171 SVILAGENLDNHKNVRDMVLDIGLYFQIVVRLSLSF 64 ++++AGE+LDNH V+++++D+G+YFQ+ V LS +F Sbjct: 89 ALLMAGEDLDNHVTVQNVLIDMGIYFQVQVSLSATF 124 Score = 30.0 bits (66), Expect(2) = 9e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 218 HHHIVQYKTSIYSCYLPL 165 H IVQYKT+ YS YLP+ Sbjct: 69 HRRIVQYKTAYYSFYLPV 86