BLASTX nr result
ID: Mentha22_contig00049477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049477 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21609.1| hypothetical protein MIMGU_mgv1a015957mg [Mimulus... 42 4e-07 >gb|EYU21609.1| hypothetical protein MIMGU_mgv1a015957mg [Mimulus guttatus] Length = 139 Score = 41.6 bits (96), Expect(2) = 4e-07 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +1 Query: 1 EQGYRVAEAKGHAQEKMGPTMDRVKDKARG 90 ++ YR EAKG AQEK G MD +KDKA+G Sbjct: 5 QKSYRAGEAKGQAQEKTGQAMDTMKDKAQG 34 Score = 38.1 bits (87), Expect(2) = 4e-07 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = +3 Query: 93 RDKASEAVDAMTELSHEMKDQTGSYADEAGDKAASTVQ 206 +DKASEA DA S E K+QTG Y A +KA+ Q Sbjct: 36 KDKASEAADAAKGHSREAKEQTGGYMGAAKEKASGAAQ 73