BLASTX nr result
ID: Mentha22_contig00049429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049429 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173375.1| hypothetical protein NitaMp028 [Nicotiana tabac... 101 1e-19 >ref|YP_173375.1| hypothetical protein NitaMp028 [Nicotiana tabacum] gi|57014031|ref|YP_173502.1| hypothetical protein NitaMp165 [Nicotiana tabacum] gi|56806537|dbj|BAD83438.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] gi|56806667|dbj|BAD83568.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 197 Score = 101 bits (251), Expect = 1e-19 Identities = 50/111 (45%), Positives = 70/111 (63%) Frame = -3 Query: 343 PVTELPDLNVPASPPEEEQPWVPLTPIVGSLPLDSQRQIARLERFQKSMIRVSTGMLRAL 164 P +PDLN+P P EE P+ PL P GSL ++ QR I R R Q ++R +T MLR+L Sbjct: 75 PEPIIPDLNLPPEEPPEE-PYQPLIPGGGSLSVEEQRAIDRFVRQQNRLVRCATHMLRSL 133 Query: 163 KFDPQKDDVKQVVENLTDRVDPIHFQDILVGMVDRNSPVFLSFLQAWEDFL 11 + PQ +DVK VVE +D H+ +I + ++DR+SP FL FL+ WE+ L Sbjct: 134 DYSPQPEDVKNVVETFILEIDSFHYSEIYLALIDRDSPQFLHFLELWEEHL 184