BLASTX nr result
ID: Mentha22_contig00049217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049217 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38160.1| hypothetical protein MIMGU_mgv1a012058mg [Mimulus... 59 7e-07 >gb|EYU38160.1| hypothetical protein MIMGU_mgv1a012058mg [Mimulus guttatus] Length = 263 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 317 EEEYAWLEEIDTPDDLYMRNGSYTGPRIEK 228 EEEYAWL EIDTPDDLYMR+G+YTGP I K Sbjct: 234 EEEYAWLSEIDTPDDLYMRSGTYTGPPIHK 263