BLASTX nr result
ID: Mentha22_contig00049189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049189 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22283.1| hypothetical protein MIMGU_mgv1a024824mg [Mimulus... 65 1e-08 >gb|EYU22283.1| hypothetical protein MIMGU_mgv1a024824mg [Mimulus guttatus] Length = 332 Score = 65.1 bits (157), Expect = 1e-08 Identities = 46/102 (45%), Positives = 56/102 (54%), Gaps = 1/102 (0%) Frame = -1 Query: 351 SAFGSDNIESS-VGDEHKFRLSPASCATKNDHGTSNASSIEEHGFRLPMKIGSENKSTMK 175 S D ESS V + HK R+SP S ND +S + E+ + +EN++ K Sbjct: 116 SVLSPDKFESSNVSEIHKSRISPPSSCADNDALSSADLFLAEN----KNENENENENENK 171 Query: 174 LELFPQETESTLDSPYTVEPRASIKLFGKTVVVRDTPKQSLE 49 EL QETES YT SIKLFGKTVV+RDT KQSLE Sbjct: 172 FELCTQETESCTRESYTT----SIKLFGKTVVIRDTQKQSLE 209