BLASTX nr result
ID: Mentha22_contig00049036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00049036 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 71 5e-14 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 72 8e-11 tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea m... 56 6e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 71.2 bits (173), Expect(2) = 5e-14 Identities = 38/44 (86%), Positives = 38/44 (86%) Frame = +1 Query: 52 VDATDLIGLSLGMETY*VITFKFRETPELIKMGNPEPNPVFPKQ 183 VDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP F KQ Sbjct: 5 VDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQ 47 Score = 32.0 bits (71), Expect(2) = 5e-14 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 186 VSKNEKKRIGAETQWKLF 239 + KKRIGAETQWKLF Sbjct: 52 LESENKKRIGAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 72.0 bits (175), Expect = 8e-11 Identities = 42/63 (66%), Positives = 46/63 (73%) Frame = +1 Query: 52 VDATDLIGLSLGMETY*VITFKFRETPELIKMGNPEPNPVFPKQRFQKTKKKG*VQRLNG 231 VDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP F KQ K+ + +R+ G Sbjct: 5 VDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQ-INKSLESENQKRIGG 62 Query: 232 SCS 240 S Sbjct: 63 GVS 65 >tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea mays] Length = 73 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = -1 Query: 199 SFFETFVLGKQDLAQDCPFLLIPGFL*I*KLSLSKFPYQGSIQLSP 62 S T K+DLAQDCPF I GFL I KL LS+FPYQGSIQ SP Sbjct: 29 SSLRTLAFSKKDLAQDCPFF-IRGFLGIWKLPLSRFPYQGSIQSSP 73