BLASTX nr result
ID: Mentha22_contig00048969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00048969 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partia... 67 3e-09 gb|EYU26792.1| hypothetical protein MIMGU_mgv1a0006321mg, partia... 57 3e-06 >gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partial [Mimulus guttatus] Length = 821 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = -1 Query: 330 CIPEEGNYCSAIYSTLSSPVSALKFATSGFRFVAGFDYGQVRIVSTKIIELLIAS*LENS 151 C+PEE N+CSAI+S +SPV AL+FATSG R V GF GQV ++ T+ +L S +S Sbjct: 555 CLPEERNHCSAIFSISTSPVCALQFATSGVRLVVGFQSGQVAVLDTRSPSVLFVSDYVSS 614 Query: 150 VKSYIVPI 127 +S ++ + Sbjct: 615 SRSPVISL 622 >gb|EYU26792.1| hypothetical protein MIMGU_mgv1a0006321mg, partial [Mimulus guttatus] Length = 832 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/62 (45%), Positives = 41/62 (66%) Frame = -1 Query: 312 NYCSAIYSTLSSPVSALKFATSGFRFVAGFDYGQVRIVSTKIIELLIAS*LENSVKSYIV 133 N+CSAI+S +SPV AL+FATSG R V GF GQV ++ T+ +L S +S +S ++ Sbjct: 572 NHCSAIFSISTSPVCALQFATSGVRLVVGFQSGQVAVLDTRSPSVLFVSDYVSSSRSPVI 631 Query: 132 PI 127 + Sbjct: 632 SL 633