BLASTX nr result
ID: Mentha22_contig00048729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00048729 (516 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44709.1| hypothetical protein MIMGU_mgv1a016019mg [Mimulus... 62 1e-07 ref|XP_004244098.1| PREDICTED: oral cancer-overexpressed protein... 57 3e-06 >gb|EYU44709.1| hypothetical protein MIMGU_mgv1a016019mg [Mimulus guttatus] gi|604346247|gb|EYU44710.1| hypothetical protein MIMGU_mgv1a016019mg [Mimulus guttatus] Length = 137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 516 ESVSDLMDALRLKFRAICASLNLKLEYEGYPKAAD 412 ES SD++DALRLKFRAICASLN+KLEY GYPK +D Sbjct: 100 ESGSDMIDALRLKFRAICASLNMKLEYNGYPKTSD 134 >ref|XP_004244098.1| PREDICTED: oral cancer-overexpressed protein 1 homolog [Solanum lycopersicum] Length = 145 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -1 Query: 516 ESVSDLMDALRLKFRAICASLNLKLEYEGYPKAA 415 ES +D++D+LRLKFRAICA+LN+K EY+GYPKA+ Sbjct: 105 ESATDIIDSLRLKFRAICATLNIKPEYDGYPKAS 138