BLASTX nr result
ID: Mentha22_contig00047762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047762 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21917.1| hypothetical protein MIMGU_mgv1a017906mg [Mimulus... 60 2e-07 >gb|EYU21917.1| hypothetical protein MIMGU_mgv1a017906mg [Mimulus guttatus] Length = 581 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +3 Query: 189 RISELLQNPAMKPGPDLEEALTAAEINPTATLLLGIFKKFDSS 317 RISE+L NPA++PGPDLE ALTAAE++P++ LLL +F +F S+ Sbjct: 65 RISEVLSNPAIQPGPDLERALTAAEVDPSSNLLLEVFNRFVSA 107