BLASTX nr result
ID: Mentha22_contig00047722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047722 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42386.1| hypothetical protein MIMGU_mgv1a007080mg [Mimulus... 58 2e-06 gb|EYU29380.1| hypothetical protein MIMGU_mgv1a0235092mg, partia... 58 2e-06 >gb|EYU42386.1| hypothetical protein MIMGU_mgv1a007080mg [Mimulus guttatus] Length = 420 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 335 RVDFMEQMLVNGKALPPQHSVQTSIYAQNKT 243 RVDF+EQ+LVNGK L PQHSVQTSIYAQNKT Sbjct: 390 RVDFLEQVLVNGKNLSPQHSVQTSIYAQNKT 420 >gb|EYU29380.1| hypothetical protein MIMGU_mgv1a0235092mg, partial [Mimulus guttatus] Length = 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 335 RVDFMEQMLVNGKALPPQHSVQTSIYAQNKT 243 RVDF+EQ+LVNGK L PQHSVQTSIYAQNKT Sbjct: 295 RVDFLEQVLVNGKNLSPQHSVQTSIYAQNKT 325