BLASTX nr result
ID: Mentha22_contig00047718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047718 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU74167.1| argonaute/ago1/eukaryotic translation initiation... 115 8e-24 gb|EPQ63544.1| hypothetical protein BGT96224_1037B [Blumeria gra... 115 8e-24 ref|XP_007297279.1| piwi domain-containing protein [Marssonina b... 67 3e-09 gb|EMR85799.1| putative piwi domain-containing protein [Botryoti... 59 9e-07 emb|CCD50704.1| similar to eukaryotic translation initiation fac... 59 9e-07 ref|XP_001554351.1| hypothetical protein BC1G_06939 [Botryotinia... 59 9e-07 gb|EPE35330.1| Ribonuclease H-like protein [Glarea lozoyensis AT... 55 8e-06 >emb|CCU74167.1| argonaute/ago1/eukaryotic translation initiation factor 2c [Blumeria graminis f. sp. hordei DH14] Length = 944 Score = 115 bits (287), Expect = 8e-24 Identities = 52/67 (77%), Positives = 62/67 (92%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKFEELRQDIANKAPTSITDSTQFTDEVRPLAPLGSTNNLDAMVK 200 RAHEDVFAS+GPRGGQKFEELRQD AN+APTSIT S+Q +EVRPLAP+G+T+NL++M+K Sbjct: 877 RAHEDVFASEGPRGGQKFEELRQDAANQAPTSITGSSQLLEEVRPLAPMGTTDNLESMIK 936 Query: 199 IRTSMWY 179 IRT MWY Sbjct: 937 IRTGMWY 943 >gb|EPQ63544.1| hypothetical protein BGT96224_1037B [Blumeria graminis f. sp. tritici 96224] Length = 601 Score = 115 bits (287), Expect = 8e-24 Identities = 52/67 (77%), Positives = 62/67 (92%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKFEELRQDIANKAPTSITDSTQFTDEVRPLAPLGSTNNLDAMVK 200 RAHEDVFAS+GPRGGQKFEELRQD AN+APTSIT S+Q +EVRPLAP+G+T+NL++M+K Sbjct: 534 RAHEDVFASEGPRGGQKFEELRQDAANQAPTSITGSSQLLEEVRPLAPMGTTDNLESMIK 593 Query: 199 IRTSMWY 179 IRT MWY Sbjct: 594 IRTGMWY 600 >ref|XP_007297279.1| piwi domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859289|gb|EKD12356.1| piwi domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 1106 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/73 (50%), Positives = 42/73 (57%), Gaps = 6/73 (8%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKFEELRQD------IANKAPTSITDSTQFTDEVRPLAPLGSTNN 218 RAHE ASDGPRGGQKFEE QD + A S T E PL PLG+ + Sbjct: 1033 RAHESNPASDGPRGGQKFEEKIQDDVALRRVNTAAHGSSQTGTSVRTEAAPLMPLGNPES 1092 Query: 217 LDAMVKIRTSMWY 179 ++ M KIRTSMWY Sbjct: 1093 VEIMTKIRTSMWY 1105 >gb|EMR85799.1| putative piwi domain-containing protein [Botryotinia fuckeliana BcDW1] Length = 939 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKF-----EELRQDIANKAPTSITDSTQFTDEVRPLAPLGSTN-- 221 RAHE S GPRGG+KF +E + +A KAP+S T S+Q E PL PLG + Sbjct: 862 RAHEATGHSAGPRGGEKFLEKQAKEAQNKVAGKAPSSQTGSSQVVVEDVPLLPLGQLSQN 921 Query: 220 ---NLDAMVKIRTSMWY 179 N D + K+R MWY Sbjct: 922 DKVNPDVLAKLRNGMWY 938 >emb|CCD50704.1| similar to eukaryotic translation initiation factor 2C 2 [Botryotinia fuckeliana T4] Length = 939 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKF-----EELRQDIANKAPTSITDSTQFTDEVRPLAPLGSTN-- 221 RAHE S GPRGG+KF +E + +A KAP+S T S+Q E PL PLG + Sbjct: 862 RAHEATGHSAGPRGGEKFLEKQAKEAQNKVAGKAPSSQTGSSQVVVEDVPLLPLGQLSQN 921 Query: 220 ---NLDAMVKIRTSMWY 179 N D + K+R MWY Sbjct: 922 DKVNPDVLAKLRNGMWY 938 >ref|XP_001554351.1| hypothetical protein BC1G_06939 [Botryotinia fuckeliana B05.10] Length = 939 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKF-----EELRQDIANKAPTSITDSTQFTDEVRPLAPLGSTN-- 221 RAHE S GPRGG+KF +E + +A KAP+S T S+Q E PL PLG + Sbjct: 862 RAHEATGHSAGPRGGEKFLEKQAKEAQNKVAGKAPSSQTGSSQVVVEDVPLLPLGQLSQN 921 Query: 220 ---NLDAMVKIRTSMWY 179 N D + K+R MWY Sbjct: 922 DKVNPDVLAKLRNGMWY 938 >gb|EPE35330.1| Ribonuclease H-like protein [Glarea lozoyensis ATCC 20868] Length = 911 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/77 (42%), Positives = 41/77 (53%), Gaps = 10/77 (12%) Frame = -1 Query: 379 RAHEDVFASDGPRGGQKFEELRQDI---------ANKAPTSITDSTQFTDEVRPLAPLGS 227 R HE +SDGP+GGQK+EE +QD ++ P S + S E RPL PL Sbjct: 834 RCHEPGASSDGPKGGQKYEEAQQDAGVRQRAGGGGSQPPASSSGSQAALSEARPLVPLAC 893 Query: 226 TNNLDAMVK-IRTSMWY 179 A +K IRTSMWY Sbjct: 894 DVKDPAALKYIRTSMWY 910