BLASTX nr result
ID: Mentha22_contig00047418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047418 (648 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362840.1| PREDICTED: putative late blight resistance p... 42 3e-06 >ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like [Solanum tuberosum] Length = 876 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 18/43 (41%), Positives = 31/43 (72%) Frame = +1 Query: 304 LEHLIIKICWVL*EIPCEIGDIGTLKVIEIDRSTPDSCRFSTL 432 L+HL+++ C+ L EIP EIGDI +L+VI++ +P + R + + Sbjct: 813 LQHLVLRFCYKLKEIPYEIGDIPSLQVIKLHSCSPYATRLARM 855 Score = 35.4 bits (80), Expect(2) = 3e-06 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 173 QIICSLPNLEALKLMAFDFVDR*WET-ERGLTSLKFLKLSER 295 +++ +LPNLE LKL F F WET E G LK+L + R Sbjct: 754 RVLGNLPNLEVLKLKDFSFQGPEWETDEEGFHRLKYLLVESR 795