BLASTX nr result
ID: Mentha22_contig00047417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047417 (565 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004489892.1| PREDICTED: paired amphipathic helix protein ... 57 4e-06 >ref|XP_004489892.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Cicer arietinum] Length = 1421 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 10/60 (16%) Frame = -3 Query: 560 NGLEIKVACNTLKAAYVIGTEDFLYRLSKRRKT----------PNSANGCSRRVRRTCRL 411 NGLE K+ACN+ K +YV+ TED+L+R ++R+T S+N CS RV+R C+L Sbjct: 1358 NGLECKIACNSSKVSYVLDTEDYLFRTKRKRRTLYQNNSYREQAMSSNTCSSRVQRFCKL 1417