BLASTX nr result
ID: Mentha22_contig00047354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047354 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36770.1| hypothetical protein MIMGU_mgv1a020773mg, partial... 78 1e-12 ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_003518493.2| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_003617308.1| Auxin response factor [Medicago truncatula] ... 67 3e-09 ref|XP_007014264.1| Pentatricopeptide repeat-containing protein,... 66 4e-09 ref|XP_007214186.1| hypothetical protein PRUPE_ppa020045mg [Prun... 66 4e-09 ref|XP_003635514.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CBI38482.3| unnamed protein product [Vitis vinifera] 64 2e-08 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 64 2e-08 ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citr... 59 5e-07 ref|XP_006380898.1| hypothetical protein POPTR_0006s01700g [Popu... 59 5e-07 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 56 4e-06 ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >gb|EYU36770.1| hypothetical protein MIMGU_mgv1a020773mg, partial [Mimulus guttatus] Length = 623 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKR 150 DAVTYNILIGSYCK GLF EA ALL+RGV GL P+ VTWHILV+ + KR Sbjct: 574 DAVTYNILIGSYCKAGLFNEAYALLDRGVVGGLVPSTVTWHILVTNLLKR 623 >ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Cicer arietinum] gi|502151414|ref|XP_004508429.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Cicer arietinum] gi|502151416|ref|XP_004508430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Cicer arietinum] gi|502151418|ref|XP_004508431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X4 [Cicer arietinum] Length = 712 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKRVLR 159 DAVTYN LI YC EGLF EAC LL +GV +G PN +TW IL+SY K+ R Sbjct: 659 DAVTYNTLISRYCYEGLFNEACLLLYKGVNNGFIPNEITWSILISYFVKKYQR 711 >ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 711 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 DA+TYN LI +CKEG +AC LL+RGV +G PN VTW+ILVS +SK Sbjct: 653 DAITYNTLISWHCKEGRISDACLLLHRGVTNGFIPNHVTWYILVSNLSK 701 >ref|XP_003518493.2| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Glycine max] Length = 739 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKRV 153 DA+TYN LI +C EG+F +AC LL +GV SG PN VTW IL++Y+ K++ Sbjct: 670 DAITYNTLISRHCHEGMFNDACLLLYKGVDSGFIPNEVTWSILINYIVKKI 720 >ref|XP_003617308.1| Auxin response factor [Medicago truncatula] gi|355518643|gb|AET00267.1| Auxin response factor [Medicago truncatula] Length = 948 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 DAVTYN LI YC EGLF +AC LL +GV++G PN +TW IL++Y K Sbjct: 651 DAVTYNTLISRYCYEGLFNDACQLLFKGVSNGFIPNEITWSILINYFVK 699 >ref|XP_007014264.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581139|ref|XP_007014265.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581142|ref|XP_007014266.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784627|gb|EOY31883.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784628|gb|EOY31884.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784629|gb|EOY31885.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 716 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVS 135 DA+TYN LI +CKEG+F+EAC LL+RGV G PN VTW ILVS Sbjct: 655 DAITYNTLISWHCKEGVFDEACLLLHRGVEYGFVPNDVTWFILVS 699 >ref|XP_007214186.1| hypothetical protein PRUPE_ppa020045mg [Prunus persica] gi|462410051|gb|EMJ15385.1| hypothetical protein PRUPE_ppa020045mg [Prunus persica] Length = 313 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 D +TYN LI +CKEG+ +AC LLNRGV +GL PN +TW+ILVS + K Sbjct: 254 DVITYNTLISWHCKEGMIYDACLLLNRGVNNGLVPNHLTWYILVSNLFK 302 >ref|XP_003635514.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 347 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 DA+TYN LI +CKEG+F++A LL+RGV SG PN VTW+ILVS K Sbjct: 293 DAITYNTLISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIK 341 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 DA+TYN LI +CKEG+F++A LL+RGV SG PN VTW+ILVS K Sbjct: 686 DAITYNTLISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIK 734 >emb|CBI38482.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 DA+TYN LI +CKEG+F++A LL+RGV SG PN VTW+ILVS K Sbjct: 314 DAITYNTLISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIK 362 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSK 147 DA+TYN LI +CKEG+F++A LL+RGV SG PN VTW+ILVS K Sbjct: 668 DAITYNTLISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIK 716 >ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Citrus sinensis] gi|568867543|ref|XP_006487096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Citrus sinensis] Length = 728 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKRV 153 DAVTYN LI + KEGLF++A +L++GVA+G PN TW+ILV + K + Sbjct: 671 DAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEI 721 >ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] gi|557524968|gb|ESR36274.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] Length = 728 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKRV 153 DAVTYN LI + KEGLF++A +L++GVA+G PN TW+ILV + K + Sbjct: 671 DAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEI 721 >ref|XP_006380898.1| hypothetical protein POPTR_0006s01700g [Populus trichocarpa] gi|550335238|gb|ERP58695.1| hypothetical protein POPTR_0006s01700g [Populus trichocarpa] Length = 576 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKR 150 D++TYN LI C+EG F++AC LL RGV +G PN VTW+ILV K+ Sbjct: 513 DSITYNTLICWLCREGAFDDACFLLYRGVENGFVPNDVTWNILVYNFGKQ 562 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILVSYMSKRV 153 DA+TYN LI +C+ G+F++A LL RGV + PN VTW+ILVS K + Sbjct: 659 DAITYNTLICWHCRAGMFDDAYLLLLRGVENAFIPNDVTWYILVSNFIKEI 709 >ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565372595|ref|XP_006352877.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILV 132 D +TYN LI SYCK + ++A L RG+A G PN VTW+ILV Sbjct: 662 DTITYNTLISSYCKMRMLDDAYTLFTRGIAVGFIPNSVTWYILV 705 >ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Solanum lycopersicum] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +1 Query: 1 DAVTYNILIGSYCKEGLFEEACALLNRGVASGLTPNFVTWHILV 132 D +TYN LI SYCK + ++A L RG+A G PN VTW+ILV Sbjct: 662 DTITYNTLISSYCKMRMLDDAYTLFTRGIAVGFIPNSVTWYILV 705