BLASTX nr result
ID: Mentha22_contig00047257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047257 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007296073.1| protein precursor [Marssonina brunnea f. sp.... 79 5e-13 gb|EPE34588.1| protein precursor [Glarea lozoyensis ATCC 20868] 78 1e-12 dbj|GAD99327.1| conserved hypothetical protein [Byssochlamys spe... 77 3e-12 gb|EPS26070.1| hypothetical protein PDE_01006 [Penicillium oxali... 76 6e-12 emb|CCU76644.1| hypothetical protein BGHDH14_bgh01788 [Blumeria ... 74 2e-11 gb|EPQ61947.1| hypothetical protein BGT96224_2160 [Blumeria gram... 74 2e-11 ref|XP_001822911.1| protein precursor [Aspergillus oryzae RIB40]... 74 2e-11 gb|EER40554.1| conserved hypothetical protein [Ajellomyces capsu... 74 2e-11 ref|XP_002845390.1| hypothetical protein MCYG_05259 [Arthroderma... 74 2e-11 ref|XP_001539289.1| conserved hypothetical protein [Ajellomyces ... 74 2e-11 ref|XP_001214833.1| protein precursor [Aspergillus terreus NIH26... 74 3e-11 emb|CDM37648.1| Protein of unknown function DUF2015 [Penicillium... 73 5e-11 gb|EEH11429.1| conserved hypothetical protein [Ajellomyces capsu... 72 6e-11 ref|XP_002488187.1| conserved hypothetical protein [Talaromyces ... 72 6e-11 gb|EGE05723.1| hypothetical protein TEQG_04731 [Trichophyton equ... 72 8e-11 tpe|CBF70861.1| TPA: hypothetical protein ANIA_10827 [Aspergillu... 72 8e-11 gb|EEH46281.1| conserved hypothetical protein [Paracoccidioides ... 72 8e-11 ref|XP_002795119.1| conserved hypothetical protein [Paracoccidio... 72 8e-11 ref|XP_002153253.1| conserved hypothetical protein [Talaromyces ... 72 1e-10 ref|XP_747558.1| conserved hypothetical protein [Aspergillus fum... 71 1e-10 >ref|XP_007296073.1| protein precursor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860408|gb|EKD13466.1| protein precursor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 130 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EIQ IMK+RRVNF+EARR+HTE RFAKNNIG DG PRDPKFV FS Sbjct: 85 REIQHIMKSRRVNFDEARRIHTEGRFAKNNIGPDGLPRDPKFVSFS 130 >gb|EPE34588.1| protein precursor [Glarea lozoyensis ATCC 20868] Length = 97 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EIQ IM+NRRVNF+EARR++TE RFAKNNIG DG PRDPKFV FS Sbjct: 52 REIQKIMRNRRVNFDEARRIYTEGRFAKNNIGPDGLPRDPKFVSFS 97 >dbj|GAD99327.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 124 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EI+ +M++RRVNF+EARRL+TE RFAKNNIG DGRPRDPKFV FS Sbjct: 79 REIRKLMRSRRVNFDEARRLYTEQRFAKNNIGPDGRPRDPKFVSFS 124 >gb|EPS26070.1| hypothetical protein PDE_01006 [Penicillium oxalicum 114-2] Length = 124 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EIQ IMK RRV+F+EARR++TE RFA+NNIG DGRPRDPKFV FS Sbjct: 79 REIQRIMKTRRVSFDEARRIYTEQRFARNNIGPDGRPRDPKFVSFS 124 >emb|CCU76644.1| hypothetical protein BGHDH14_bgh01788 [Blumeria graminis f. sp. hordei DH14] Length = 126 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EIQ IMK+RRVNF+EARR+ TE FAKN+I SDG PRDPKFVCFS Sbjct: 81 REIQGIMKSRRVNFDEARRIFTEGCFAKNDISSDGLPRDPKFVCFS 126 >gb|EPQ61947.1| hypothetical protein BGT96224_2160 [Blumeria graminis f. sp. tritici 96224] Length = 128 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EIQ IMK+RRVNF+EARR+ TE FAKN+I SDG PRDPKFVCFS Sbjct: 83 REIQGIMKSRRVNFDEARRIFTEGCFAKNDISSDGLPRDPKFVCFS 128 >ref|XP_001822911.1| protein precursor [Aspergillus oryzae RIB40] gi|238493970|ref|XP_002378221.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|83771648|dbj|BAE61778.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220694871|gb|EED51214.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|391871247|gb|EIT80409.1| protein precursor [Aspergillus oryzae 3.042] Length = 124 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 ++I IMK +R+NF+EARR++TE RFAKNNIG DGRPRDPKFV FS Sbjct: 79 RQIMKIMKRQRINFDEARRIYTEQRFAKNNIGPDGRPRDPKFVSFS 124 >gb|EER40554.1| conserved hypothetical protein [Ajellomyces capsulatus H143] gi|325094982|gb|EGC48292.1| conserved hypothetical protein [Ajellomyces capsulatus H88] Length = 123 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+ IMK +RVNFNEARR++TE RFAKN IG DGRPRDPKFV FS Sbjct: 78 REVLKIMKRQRVNFNEARRIYTERRFAKNGIGPDGRPRDPKFVSFS 123 >ref|XP_002845390.1| hypothetical protein MCYG_05259 [Arthroderma otae CBS 113480] gi|238842778|gb|EEQ32440.1| hypothetical protein MCYG_05259 [Arthroderma otae CBS 113480] Length = 123 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +2 Query: 5 EIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 E+ IMK+R+V+FNEARR++TE RFAKNNIG DGRPRDPKFV FS Sbjct: 79 EVLRIMKSRKVDFNEARRIYTEQRFAKNNIGPDGRPRDPKFVSFS 123 >ref|XP_001539289.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] gi|150414362|gb|EDN09727.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] Length = 123 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+ IMK +RVNFNEARR++TE RFAKN IG DGRPRDPKFV FS Sbjct: 78 REVLKIMKRQRVNFNEARRIYTERRFAKNGIGPDGRPRDPKFVSFS 123 >ref|XP_001214833.1| protein precursor [Aspergillus terreus NIH2624] gi|114191716|gb|EAU33416.1| protein precursor [Aspergillus terreus NIH2624] Length = 124 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E++ IMK R+V F+EARR++TE RFAKNNIG DGRPRDPKFV FS Sbjct: 79 QEVKKIMKQRKVGFDEARRIYTEQRFAKNNIGPDGRPRDPKFVSFS 124 >emb|CDM37648.1| Protein of unknown function DUF2015 [Penicillium roqueforti] Length = 124 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 KE+ IMK+++V+F+EARR++TE RFAKNNIG DGRPRDPKFV FS Sbjct: 79 KEVIKIMKSQKVDFDEARRIYTEQRFAKNNIGPDGRPRDPKFVSFS 124 >gb|EEH11429.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] Length = 123 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+ IMK + VNFNEARR++TE RFAKN IG DGRPRDPKFV FS Sbjct: 78 REVLKIMKRQHVNFNEARRIYTERRFAKNGIGPDGRPRDPKFVSFS 123 >ref|XP_002488187.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218713108|gb|EED12533.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 125 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EI+ IMK R V+F+EARRL+TE RFAKNNIG DGRP+DPKFV FS Sbjct: 80 REIRRIMKRRGVDFDEARRLYTEQRFAKNNIGPDGRPKDPKFVSFS 125 >gb|EGE05723.1| hypothetical protein TEQG_04731 [Trichophyton equinum CBS 127.97] gi|607891610|gb|EZF31241.1| hypothetical protein H101_05137 [Trichophyton interdigitale H6] Length = 123 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 5 EIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 E+ IM++++V+FNEARR++TE RFAKNNIG DGRPRDPKFV FS Sbjct: 79 EVLRIMRSKKVDFNEARRIYTEQRFAKNNIGPDGRPRDPKFVSFS 123 >tpe|CBF70861.1| TPA: hypothetical protein ANIA_10827 [Aspergillus nidulans FGSC A4] Length = 123 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+ IM+ ++V+FNEARR++TE RFAKNNIG DGRPRDPKFV FS Sbjct: 78 REVLNIMRRQKVDFNEARRIYTEQRFAKNNIGPDGRPRDPKFVSFS 123 >gb|EEH46281.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18] Length = 124 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+ IMK RRV+FNEARRL+ + RF KNNIG DGRPRDPKFV FS Sbjct: 79 REVLKIMKQRRVDFNEARRLYMQQRFVKNNIGPDGRPRDPKFVSFS 124 >ref|XP_002795119.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226285812|gb|EEH41378.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 124 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+ IMK RRV+FNEARRL+ + RF KNNIG DGRPRDPKFV FS Sbjct: 79 REVLKIMKRRRVDFNEARRLYMQQRFVKNNIGPDGRPRDPKFVSFS 124 >ref|XP_002153253.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210064773|gb|EEA18868.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] Length = 125 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +EI+ IMK R V+F+EARRL+TE RFAKN+IG DGRPRDPKFV FS Sbjct: 80 REIRRIMKRRGVDFDEARRLYTEQRFAKNDIGPDGRPRDPKFVSFS 125 >ref|XP_747558.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66845185|gb|EAL85520.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|159122343|gb|EDP47464.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 124 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +2 Query: 2 KEIQVIMKNRRVNFNEARRLHTEARFAKNNIGSDGRPRDPKFVCFS 139 +E+Q IMK + VNF+EARR++TE RFA +NIG DGRPRDPKFV FS Sbjct: 79 REVQKIMKTQNVNFDEARRIYTERRFATHNIGPDGRPRDPKFVSFS 124