BLASTX nr result
ID: Mentha22_contig00047159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00047159 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494733.1| PREDICTED: uncharacterized protein LOC102619... 60 2e-07 ref|XP_006494732.1| PREDICTED: uncharacterized protein LOC102619... 60 2e-07 ref|XP_006494731.1| PREDICTED: uncharacterized protein LOC102619... 60 2e-07 ref|XP_006468700.1| PREDICTED: uncharacterized protein LOC102618... 60 2e-07 ref|XP_006448472.1| hypothetical protein CICLE_v10014060mg [Citr... 60 2e-07 ref|XP_006428003.1| hypothetical protein CICLE_v10027267mg, part... 60 2e-07 ref|XP_006493673.1| PREDICTED: uncharacterized protein LOC102629... 58 1e-06 ref|XP_006446008.1| hypothetical protein CICLE_v10018184mg, part... 58 1e-06 ref|XP_007026910.1| Cysteine/Histidine-rich C1 domain family pro... 57 3e-06 gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial... 56 6e-06 gb|EXB57302.1| hypothetical protein L484_011389 [Morus notabilis] 56 6e-06 ref|XP_006398316.1| hypothetical protein EUTSA_v10000813mg [Eutr... 55 8e-06 ref|NP_175966.1| cysteine/histidine-rich C1 domain-containing pr... 55 8e-06 >ref|XP_006494733.1| PREDICTED: uncharacterized protein LOC102619482 isoform X3 [Citrus sinensis] Length = 1026 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 102 EIEEEIETVDHLSHEHPLTLVETRTKD--YCYGCRMYFISGEQAYGCSKKCGYTRLLHEE 275 +++E +T H SHEH L L E + D +C GC + E AYGC + C Y LH+ Sbjct: 587 QVDERQKTTKHFSHEHLLFLYENKWNDDIFCDGCGNDIQANEPAYGCDQ-CDY--YLHKS 643 Query: 276 CAALPRRITHAMHQHVL 326 CA LPR H H+H L Sbjct: 644 CAELPRERQHPFHRHPL 660 >ref|XP_006494732.1| PREDICTED: uncharacterized protein LOC102619482 isoform X2 [Citrus sinensis] Length = 1027 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 102 EIEEEIETVDHLSHEHPLTLVETRTKD--YCYGCRMYFISGEQAYGCSKKCGYTRLLHEE 275 +++E +T H SHEH L L E + D +C GC + E AYGC + C Y LH+ Sbjct: 587 QVDERQKTTKHFSHEHLLFLYENKWNDDIFCDGCGNDIQANEPAYGCDQ-CDY--YLHKS 643 Query: 276 CAALPRRITHAMHQHVL 326 CA LPR H H+H L Sbjct: 644 CAELPRERQHPFHRHPL 660 >ref|XP_006494731.1| PREDICTED: uncharacterized protein LOC102619482 isoform X1 [Citrus sinensis] Length = 1059 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 102 EIEEEIETVDHLSHEHPLTLVETRTKD--YCYGCRMYFISGEQAYGCSKKCGYTRLLHEE 275 +++E +T H SHEH L L E + D +C GC + E AYGC + C Y LH+ Sbjct: 587 QVDERQKTTKHFSHEHLLFLYENKWNDDIFCDGCGNDIQANEPAYGCDQ-CDY--YLHKS 643 Query: 276 CAALPRRITHAMHQHVL 326 CA LPR H H+H L Sbjct: 644 CAELPRERQHPFHRHPL 660 >ref|XP_006468700.1| PREDICTED: uncharacterized protein LOC102618382 [Citrus sinensis] Length = 1272 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 111 EEIETVDHLSHEHPLTLVETRTKD---YCYGCRMYFISGEQAYGCSKKCGYTRLLHEECA 281 +E E ++H SH+H L LV + D CY C + G+ YGC + Y LH+ CA Sbjct: 748 DEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEK-LVRGQPTYGCDQCRFY---LHKSCA 803 Query: 282 ALPRRITHAMHQHVLI 329 LPR+I HA+H+H LI Sbjct: 804 ELPRQIQHALHRHSLI 819 >ref|XP_006448472.1| hypothetical protein CICLE_v10014060mg [Citrus clementina] gi|557551083|gb|ESR61712.1| hypothetical protein CICLE_v10014060mg [Citrus clementina] Length = 1272 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = +3 Query: 111 EEIETVDHLSHEHPLTLVETRTKD---YCYGCRMYFISGEQAYGCSKKCGYTRLLHEECA 281 +E E ++H SH+H L LV + D CY C + G+ YGC + Y LH+ CA Sbjct: 748 DEREKLNHFSHDHCLFLVGNQRDDDGAVCYACEK-LVRGQPTYGCDQCRFY---LHKSCA 803 Query: 282 ALPRRITHAMHQHVLI 329 LPR+I HA+H+H LI Sbjct: 804 ELPRQIQHALHRHSLI 819 >ref|XP_006428003.1| hypothetical protein CICLE_v10027267mg, partial [Citrus clementina] gi|557529993|gb|ESR41243.1| hypothetical protein CICLE_v10027267mg, partial [Citrus clementina] Length = 853 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 102 EIEEEIETVDHLSHEHPLTLVETRTKD--YCYGCRMYFISGEQAYGCSKKCGYTRLLHEE 275 +++E +T H SHEH L L E + D +C GC + E AYGC + C Y LH+ Sbjct: 714 QVDERQKTTKHFSHEHLLFLYENKWNDDIFCDGCGNDIQANEPAYGCDQ-CDY--YLHKS 770 Query: 276 CAALPRRITHAMHQHVL 326 CA LPR H H+H L Sbjct: 771 CAELPRERQHPFHRHPL 787 >ref|XP_006493673.1| PREDICTED: uncharacterized protein LOC102629364 [Citrus sinensis] Length = 735 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/94 (36%), Positives = 43/94 (45%), Gaps = 7/94 (7%) Frame = +3 Query: 108 EEEIETVDHLSHEHPLTLV-----ETRTKDYCYGCRMYFISGEQAYGCS--KKCGYTRLL 266 E + E + H SH HPL L ET CY C +G AY C+ K C L Sbjct: 215 ECDTELIKHFSHPHPLVLCDNEEEETNDDKVCYACNKLIQAGPAAYICNSCKSC----YL 270 Query: 267 HEECAALPRRITHAMHQHVLIQQHFQHLLLCAIC 368 H+ C+ LPRRI H H++VL + C C Sbjct: 271 HKSCSELPRRIQHRFHKNVLTLVYTAASRQCKAC 304 >ref|XP_006446008.1| hypothetical protein CICLE_v10018184mg, partial [Citrus clementina] gi|557548619|gb|ESR59248.1| hypothetical protein CICLE_v10018184mg, partial [Citrus clementina] Length = 428 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/94 (36%), Positives = 43/94 (45%), Gaps = 7/94 (7%) Frame = +3 Query: 108 EEEIETVDHLSHEHPLTLV-----ETRTKDYCYGCRMYFISGEQAYGCS--KKCGYTRLL 266 E + E + H SH HPL L ET CY C +G AY C+ K C L Sbjct: 221 ECDTELIKHFSHPHPLVLCDNEEEETNDDKVCYACNKLIQAGPAAYICNSCKSC----YL 276 Query: 267 HEECAALPRRITHAMHQHVLIQQHFQHLLLCAIC 368 H+ C+ LPRRI H H++VL + C C Sbjct: 277 HKSCSELPRRIQHRFHKNVLTLVYTAASRQCKAC 310 >ref|XP_007026910.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508715515|gb|EOY07412.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 299 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = +3 Query: 120 ETVDHLSHEHPLTLVETRTKDYCYGCRMYFISGEQAYGCSKKCGYTRLLHEECAALPRRI 299 +TV H +H+HPLT V+ RT+ C GCR + YGC + C + LH+ CA P + Sbjct: 7 KTVQHFTHDHPLTEVDARTEFVCDGCRTLGVG--TRYGC-ESCDFD--LHDHCATCPLEL 61 Query: 300 THAMHQHVL 326 + MH+H L Sbjct: 62 SSFMHEHDL 70 >gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial [Mimulus guttatus] Length = 187 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 3/70 (4%) Frame = +3 Query: 114 EIETVDHLSHEHPLTLVETRTKDY--CYGCRMYFISGEQAYGCSK-KCGYTRLLHEECAA 284 E + H SH HPL L E +D+ C GC ISG AY C+K KC + LLH+ C Sbjct: 23 EKQQFSHFSHRHPLELSEVHEEDHAICSGCEHDIISGS-AYICAKPKCNF--LLHDLCFD 79 Query: 285 LPRRITHAMH 314 LPRRI H H Sbjct: 80 LPRRIRHRCH 89 >gb|EXB57302.1| hypothetical protein L484_011389 [Morus notabilis] Length = 679 Score = 55.8 bits (133), Expect = 6e-06 Identities = 36/93 (38%), Positives = 50/93 (53%), Gaps = 7/93 (7%) Frame = +3 Query: 111 EEIETVDHLSHEHPLTLVE-----TRTKDYCYGCRMYFISGEQAYGCSKKCGYTRLLHEE 275 E E + H SH+HPL LV+ +TK C+ C + SG YGC+K C + LH+ Sbjct: 121 ESQEHIQHFSHQHPLPLVQDVDNRNKTK-LCFVCHLTCSSGTD-YGCTK-CRH--FLHKS 175 Query: 276 CAALPRRITHAMH-QHVLIQQHFQHL-LLCAIC 368 CA LPR I H++H H L+ H C++C Sbjct: 176 CAELPREIKHSVHPNHGLLALGVTHAWFTCSLC 208 >ref|XP_006398316.1| hypothetical protein EUTSA_v10000813mg [Eutrema salsugineum] gi|557099405|gb|ESQ39769.1| hypothetical protein EUTSA_v10000813mg [Eutrema salsugineum] Length = 651 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Frame = +3 Query: 120 ETVDHLSHEHPLTLVETRT----KDYCYGCRMYFISGEQAYGCSKKCGYTRLLHEECAAL 287 ET+ H SH+H L L E +C C + + E Y C + C + LLHE CA+L Sbjct: 349 ETIQHFSHDHHLRLHENNKICDENRFCQACILPIMISESFYSCMQ-CDF--LLHEACASL 405 Query: 288 PRRITHAMHQHVLI 329 PR+ H +H+H LI Sbjct: 406 PRKKDHPLHKHPLI 419 >ref|NP_175966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|8778489|gb|AAF79497.1|AC002328_5 F20N2.12 [Arabidopsis thaliana] gi|225898026|dbj|BAH30345.1| hypothetical protein [Arabidopsis thaliana] gi|332195166|gb|AEE33287.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 679 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 12/94 (12%) Frame = +3 Query: 84 ITAIRKEIEEEIE--------TVDHLSHEHPLTL-VETRTKD---YCYGCRMYFISGEQA 227 + + +E +E++E T+ H SHEH L L + D +C C + + E Sbjct: 350 LDGVPEEPDEDVEPFERIDDKTIQHFSHEHYLRLNIRNGVFDADSFCQACIIPILESESF 409 Query: 228 YGCSKKCGYTRLLHEECAALPRRITHAMHQHVLI 329 YGC++ C + LLHE CA+ PR+ H +H+H LI Sbjct: 410 YGCTQ-CSF--LLHEACASFPRKKDHPLHKHRLI 440