BLASTX nr result
ID: Mentha22_contig00046928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046928 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21155.1| hypothetical protein MIMGU_mgv1a004903mg [Mimulus... 64 2e-08 >gb|EYU21155.1| hypothetical protein MIMGU_mgv1a004903mg [Mimulus guttatus] Length = 505 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = -3 Query: 347 YRTYPRDRDRARMEAIVXXXXXXXXXXXXETRGIHIQIESDERREINLDEKSIIAMPFD- 171 Y TYPRDR RAR+EAIV ++RGI ++I S E E+N+D+++I MP D Sbjct: 434 YFTYPRDRHRARIEAIVESEMQLIKSDMLDSRGIDLRIRSSEIEELNIDDRTITEMPLDY 493 Query: 170 DYSDERTLLVTR 135 D SDERTL+ R Sbjct: 494 DDSDERTLIPRR 505