BLASTX nr result
ID: Mentha22_contig00046907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046907 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus... 57 3e-06 >gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus guttatus] Length = 888 Score = 57.0 bits (136), Expect = 3e-06 Identities = 52/136 (38%), Positives = 66/136 (48%), Gaps = 17/136 (12%) Frame = +3 Query: 3 LCLREAQKEGF-YTVCPGD------EIEDEVSRTVISGSMPEIEEIDALSSTPLARSLIL 161 LCLREA+KE F Y P D + + R I S E E + AL S PL RSLI Sbjct: 478 LCLREAEKEKFLYVRIPHDLNNVPQGVINTQRRIGIHQSTSEPEALYALQSMPLVRSLIC 537 Query: 162 NLKGHDVPPHIFRLLRI---VDSSTAPGKKIRDNMHQLVNLRLFNFKIL-------KDFE 311 KG +P FRLLR+ VD +K + V RLFN + + ++ + Sbjct: 538 EFKGV-LPTLDFRLLRVLKAVDKHLYSEEKRQYKYPIEVVFRLFNSRFIAIRVDSRQNPQ 596 Query: 312 FPSLICLFWNLQILYV 359 FPS + L WNLQ L V Sbjct: 597 FPSSVNLLWNLQTLIV 612