BLASTX nr result
ID: Mentha22_contig00046891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046891 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44821.1| hypothetical protein MIMGU_mgv1a016011mg [Mimulus... 56 5e-06 >gb|EYU44821.1| hypothetical protein MIMGU_mgv1a016011mg [Mimulus guttatus] Length = 137 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = -1 Query: 105 MRRTFGSAVRT---AADCPRLTRLSLHAPKSVEVEFDN 1 M+RTF SA+R+ A+CPRLT+ SLHAPKSVEVEFDN Sbjct: 1 MKRTFESAIRSFQAVAECPRLTKFSLHAPKSVEVEFDN 38