BLASTX nr result
ID: Mentha22_contig00046860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046860 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265374.2| PREDICTED: uncharacterized protein LOC100255... 65 1e-08 ref|XP_006349292.1| PREDICTED: uncharacterized protein LOC102579... 62 6e-08 ref|XP_006349291.1| PREDICTED: uncharacterized protein LOC102579... 62 6e-08 ref|XP_007041143.1| Uncharacterized protein isoform 2 [Theobroma... 62 1e-07 ref|XP_007041142.1| Uncharacterized protein isoform 1 [Theobroma... 62 1e-07 ref|XP_004230425.1| PREDICTED: uncharacterized protein LOC101259... 61 2e-07 ref|XP_006414091.1| hypothetical protein EUTSA_v10025410mg [Eutr... 60 2e-07 ref|XP_006283920.1| hypothetical protein CARUB_v10005038mg [Caps... 59 9e-07 ref|XP_002870039.1| hypothetical protein ARALYDRAFT_493006 [Arab... 59 9e-07 ref|NP_193588.5| uncharacterized protein [Arabidopsis thaliana] ... 58 1e-06 emb|CAA16733.1| putative protein [Arabidopsis thaliana] gi|72686... 58 1e-06 ref|XP_006592650.1| PREDICTED: uncharacterized protein LOC100526... 57 2e-06 ref|XP_006592649.1| PREDICTED: uncharacterized protein LOC100526... 57 2e-06 ref|XP_006470988.1| PREDICTED: uncharacterized protein LOC102624... 57 2e-06 ref|XP_006431495.1| hypothetical protein CICLE_v10001347mg [Citr... 57 2e-06 ref|XP_006431494.1| hypothetical protein CICLE_v10001347mg [Citr... 57 2e-06 ref|XP_006431493.1| hypothetical protein CICLE_v10001347mg [Citr... 57 2e-06 ref|XP_007049550.1| Uncharacterized protein TCM_002621 [Theobrom... 57 3e-06 gb|EYU46099.1| hypothetical protein MIMGU_mgv1a007624mg [Mimulus... 56 6e-06 ref|XP_006598791.1| PREDICTED: uncharacterized protein LOC100797... 56 6e-06 >ref|XP_002265374.2| PREDICTED: uncharacterized protein LOC100255698 [Vitis vinifera] gi|297739491|emb|CBI29673.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 310 YKLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 +K+DNRSAVR +SFIEM +FR RW AVKED+CW DPY Q Sbjct: 367 HKVDNRSAVRRQSFIEMQIFRSRWANAVKEDKCWIDPYAQ 406 >ref|XP_006349292.1| PREDICTED: uncharacterized protein LOC102579538 isoform X2 [Solanum tuberosum] Length = 426 Score = 62.4 bits (150), Expect = 6e-08 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQQ 188 K DNRS VR +S+IEM +FR+RW++A+K+D+CW DP++ Q Sbjct: 380 KFDNRSLVRRQSYIEMKVFRERWRKAIKQDQCWVDPFQSQ 419 >ref|XP_006349291.1| PREDICTED: uncharacterized protein LOC102579538 isoform X1 [Solanum tuberosum] Length = 427 Score = 62.4 bits (150), Expect = 6e-08 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQQ 188 K DNRS VR +S+IEM +FR+RW++A+K+D+CW DP++ Q Sbjct: 381 KFDNRSLVRRQSYIEMKVFRERWRKAIKQDQCWVDPFQSQ 420 >ref|XP_007041143.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508705078|gb|EOX96974.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 416 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 310 YKLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 +K+DNR VR +SFIEM MFR RW+ AV +D+CW DPY+Q Sbjct: 370 HKVDNRPEVRRQSFIEMQMFRKRWENAVNQDKCWVDPYQQ 409 >ref|XP_007041142.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508705077|gb|EOX96973.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 405 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 310 YKLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 +K+DNR VR +SFIEM MFR RW+ AV +D+CW DPY+Q Sbjct: 359 HKVDNRPEVRRQSFIEMQMFRKRWENAVNQDKCWVDPYQQ 398 >ref|XP_004230425.1| PREDICTED: uncharacterized protein LOC101259678 [Solanum lycopersicum] Length = 428 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQQ 188 K DNRS VR +S+IEM +FR+RW +A+K+D+CW DP++ Q Sbjct: 380 KFDNRSLVRRQSYIEMKIFRERWGKAIKQDQCWVDPFQSQ 419 >ref|XP_006414091.1| hypothetical protein EUTSA_v10025410mg [Eutrema salsugineum] gi|557115261|gb|ESQ55544.1| hypothetical protein EUTSA_v10025410mg [Eutrema salsugineum] Length = 393 Score = 60.5 bits (145), Expect = 2e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -3 Query: 310 YKLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPY 197 +++DNR VR++SF+EM F++RWK+AVK+D CW DPY Sbjct: 356 HEVDNRPEVRMKSFVEMKRFKERWKKAVKDDRCWVDPY 393 >ref|XP_006283920.1| hypothetical protein CARUB_v10005038mg [Capsella rubella] gi|482552625|gb|EOA16818.1| hypothetical protein CARUB_v10005038mg [Capsella rubella] Length = 382 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/37 (56%), Positives = 31/37 (83%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPY 197 ++DNR VR++SF+EM F++RWK+AV++D CW DPY Sbjct: 346 EVDNRPEVRMKSFVEMKRFKERWKKAVRDDRCWVDPY 382 >ref|XP_002870039.1| hypothetical protein ARALYDRAFT_493006 [Arabidopsis lyrata subsp. lyrata] gi|297315875|gb|EFH46298.1| hypothetical protein ARALYDRAFT_493006 [Arabidopsis lyrata subsp. lyrata] Length = 315 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/37 (56%), Positives = 31/37 (83%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPY 197 ++DNR VR++SF+EM F++RWK+AV++D CW DPY Sbjct: 279 EVDNRPEVRMKSFVEMKRFKERWKKAVRDDRCWVDPY 315 >ref|NP_193588.5| uncharacterized protein [Arabidopsis thaliana] gi|332658658|gb|AEE84058.1| uncharacterized protein AT4G18530 [Arabidopsis thaliana] Length = 389 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/37 (56%), Positives = 31/37 (83%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPY 197 ++DNR VR++SF+EM F++RWK+AV++D CW DPY Sbjct: 353 EVDNRPEVRMKSFVEMKRFKERWKKAVRDDTCWVDPY 389 >emb|CAA16733.1| putative protein [Arabidopsis thaliana] gi|7268646|emb|CAB78855.1| putative protein [Arabidopsis thaliana] Length = 349 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/37 (56%), Positives = 31/37 (83%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPY 197 ++DNR VR++SF+EM F++RWK+AV++D CW DPY Sbjct: 313 EVDNRPEVRMKSFVEMKRFKERWKKAVRDDTCWVDPY 349 >ref|XP_006592650.1| PREDICTED: uncharacterized protein LOC100526994 isoform X2 [Glycine max] Length = 345 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -3 Query: 301 DNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQQN 185 DNR+ VR++S+IEM +F RWK A ++D+CW DPYEQ N Sbjct: 303 DNRAKVRMQSYIEMQVFGKRWKDAAEKDKCWIDPYEQAN 341 >ref|XP_006592649.1| PREDICTED: uncharacterized protein LOC100526994 isoform X1 [Glycine max] Length = 385 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -3 Query: 301 DNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQQN 185 DNR+ VR++S+IEM +F RWK A ++D+CW DPYEQ N Sbjct: 343 DNRAKVRMQSYIEMQVFGKRWKDAAEKDKCWIDPYEQAN 381 >ref|XP_006470988.1| PREDICTED: uncharacterized protein LOC102624954 [Citrus sinensis] Length = 407 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 + DNR VR +S+IEM +FR+RWK AV++D+CW DPY Q Sbjct: 362 RYDNRPEVRRQSYIEMQIFRNRWKHAVEDDKCWVDPYGQ 400 >ref|XP_006431495.1| hypothetical protein CICLE_v10001347mg [Citrus clementina] gi|557533617|gb|ESR44735.1| hypothetical protein CICLE_v10001347mg [Citrus clementina] Length = 358 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 + DNR VR +S+IEM +FR+RWK AV++D+CW DPY Q Sbjct: 313 RYDNRPEVRRQSYIEMQIFRNRWKHAVEDDKCWVDPYGQ 351 >ref|XP_006431494.1| hypothetical protein CICLE_v10001347mg [Citrus clementina] gi|557533616|gb|ESR44734.1| hypothetical protein CICLE_v10001347mg [Citrus clementina] Length = 407 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 + DNR VR +S+IEM +FR+RWK AV++D+CW DPY Q Sbjct: 362 RYDNRPEVRRQSYIEMQIFRNRWKHAVEDDKCWVDPYGQ 400 >ref|XP_006431493.1| hypothetical protein CICLE_v10001347mg [Citrus clementina] gi|557533615|gb|ESR44733.1| hypothetical protein CICLE_v10001347mg [Citrus clementina] Length = 316 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -3 Query: 307 KLDNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQ 191 + DNR VR +S+IEM +FR+RWK AV++D+CW DPY Q Sbjct: 271 RYDNRPEVRRQSYIEMQIFRNRWKHAVEDDKCWVDPYGQ 309 >ref|XP_007049550.1| Uncharacterized protein TCM_002621 [Theobroma cacao] gi|508701811|gb|EOX93707.1| Uncharacterized protein TCM_002621 [Theobroma cacao] Length = 385 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 295 RSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYE 194 RS VR +SFIE+ +F++RWKRAVK+D+CW DPYE Sbjct: 346 RSEVRKQSFIELEIFKNRWKRAVKQDKCWFDPYE 379 >gb|EYU46099.1| hypothetical protein MIMGU_mgv1a007624mg [Mimulus guttatus] Length = 401 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -3 Query: 301 DNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYE---QQN 185 D R+AVR SFIE+ F++RWK+AV+EDECW DP + QQN Sbjct: 360 DERNAVRRESFIELDDFKNRWKKAVREDECWVDPLQTPPQQN 401 >ref|XP_006598791.1| PREDICTED: uncharacterized protein LOC100797710 isoform X5 [Glycine max] gi|571524256|ref|XP_006598792.1| PREDICTED: uncharacterized protein LOC100797710 isoform X6 [Glycine max] Length = 309 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = -3 Query: 301 DNRSAVRIRSFIEMGMFRDRWKRAVKEDECWADPYEQQN 185 DNR+ VR++S+IEM +F RWK A ++D+CW DPYE+ N Sbjct: 267 DNRAKVRMQSYIEMQVFGKRWKDAAEKDKCWIDPYEKAN 305