BLASTX nr result
ID: Mentha22_contig00046694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00046694 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_003612306.1| HAT family dimerization domain containing pr... 65 1e-08 ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medica... 65 1e-08 ref|XP_003612304.1| F-box protein [Medicago truncatula] gi|35551... 62 1e-07 gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S... 62 1e-07 ref|XP_002528203.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago ... 60 2e-07 ref|XP_003608397.1| Tubulin beta chain [Medicago truncatula] gi|... 58 1e-06 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 392 PFQKFSTAQVKQGPKRGFGNSFQPAIDAPRLEPH 291 PFQKFS A+ K GPKRGFGNSFQPAIDAPRLEPH Sbjct: 61 PFQKFSKAKGKPGPKRGFGNSFQPAIDAPRLEPH 94 >ref|XP_003612306.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355513641|gb|AES95264.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 257 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 257 NYLCAWGNDAASEVLTEARLLLVENYFQTPS 349 N+LCAWGNDAA+EVLTEARLLLVENYFQTPS Sbjct: 222 NHLCAWGNDAANEVLTEARLLLVENYFQTPS 252 >ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355496649|gb|AES77852.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 105 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 257 NYLCAWGNDAASEVLTEARLLLVENYFQTPS 349 N+LCAWGNDAA+EVLTEARLLLVENYFQTPS Sbjct: 75 NHLCAWGNDAANEVLTEARLLLVENYFQTPS 105 >ref|XP_003612304.1| F-box protein [Medicago truncatula] gi|355513639|gb|AES95262.1| F-box protein [Medicago truncatula] Length = 254 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 251 LSNYLCAWGNDAASEVLTEARLLLVENYFQTPS 349 + N+LCAWGNDAA+EVLTEARLLLVENYFQT S Sbjct: 222 IRNHLCAWGNDAANEVLTEARLLLVENYFQTHS 254 >gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S cerevisiae. EST gb|N96627 comes from this gene [Arabidopsis thaliana] Length = 573 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 392 PFQKFSTAQVKQGPKRGFGNSFQPAIDAPRLEPH 291 PFQKFS AQ K P+RGFGNSFQPAIDAPRL PH Sbjct: 540 PFQKFSKAQDKLRPRRGFGNSFQPAIDAPRLRPH 573 >ref|XP_002528203.1| conserved hypothetical protein [Ricinus communis] gi|223532415|gb|EEF34210.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 392 PFQKFSTAQVKQGPKRGFGNSFQPAIDAPRLEPH 291 PFQKFS A+ PKRGFGNSFQPAIDAPRLEPH Sbjct: 18 PFQKFSKAEDVPRPKRGFGNSFQPAIDAPRLEPH 51 >ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago truncatula] gi|355525058|gb|AET05512.1| hypothetical protein MTR_8g106450 [Medicago truncatula] Length = 220 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 260 YLCAWGNDAASEVLTEARLLLVENYFQTPSSALA*LG 370 +LCAWGND A+EV+TEARLLLVENYFQTPS LG Sbjct: 183 HLCAWGNDVANEVITEARLLLVENYFQTPSGPELALG 219 >ref|XP_003608397.1| Tubulin beta chain [Medicago truncatula] gi|355509452|gb|AES90594.1| Tubulin beta chain [Medicago truncatula] Length = 65 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 260 YLCAWGNDAASEVLTEARLLLVENYFQTPS 349 +LCAWGNDAA+EV TE RLLLVENYFQTPS Sbjct: 36 HLCAWGNDAANEVPTEVRLLLVENYFQTPS 65