BLASTX nr result
ID: Mentha22_contig00045896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045896 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004493174.1| PREDICTED: probable glycosyltransferase At5g... 55 8e-06 >ref|XP_004493174.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer arietinum] Length = 472 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/97 (30%), Positives = 44/97 (45%) Frame = +2 Query: 59 VKSHPLISQESFNLHHHQEEVVVLPESGFREGLTATSEDDDEAPPRPSGRTTDHESESPK 238 + S P++ + LH++ E GL PP+ + + K Sbjct: 70 LSSLPVLLSPTTTLHNNASEFTKFQTFQLGHGL----------PPQSQRGLPSQSNSTRK 119 Query: 239 GGKNDDAFHQRSLFMEDYMSMNKSMKIYAYPHSKSHP 349 KN++ FH R LF+EDY MN+S KIY YPH + P Sbjct: 120 LEKNNNLFHDRDLFLEDYKEMNRSFKIYVYPHREDDP 156